KEGG   Corynebacterium doosanense: CDOO_02775Help
Entry
CDOO_02775        CDS       T03413                                 

Definition
(GenBank) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
cdo  Corynebacterium doosanense
Brite
KEGG Orthology (KO) [BR:cdo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cdo03012]
    CDOO_02775
   03029 Mitochondrial biogenesis [BR:cdo03029]
    CDOO_02775
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdo04147]
    CDOO_02775
Translation factors [BR:cdo03012]
 Eukaryotic Type
  Elongation factors
   CDOO_02775
 Prokaryotic Type
   CDOO_02775
Mitochondrial biogenesis [BR:cdo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CDOO_02775
Exosome [BR:cdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CDOO_02775
  Exosomal proteins of breast cancer cells
   CDOO_02775
  Exosomal proteins of colorectal cancer cells
   CDOO_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIT60288
UniProt: A0A097IDR5
LinkDB All DBs
Position
530373..531563
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERVKPHVNIGTIGHVDHGKTTTTAAITKVLADQYPDENEAFAFDAIDKAPEEKE
RGITINISHVEYNTPKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEDAPIIHISALGAL
NGEQKWVDSIVELMAACDESIPDPERATDQPFLMPIEDIFTITGRGTVVTGRVERGQLKV
NEEVEIIGIQEKAQKTTVTGIEMFRKLLDYTEAGDNCGLLLRGIGREDVERGQVVVKPGA
YTPHKNFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
ISVELIQPVAMDEGLRFAIREGSRTVGAGRVTKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaaattcgagcgcgtcaaaccgcacgtcaacatcggcaccatcggtcac
gtcgaccacggcaagaccaccaccaccgccgcgatcaccaaggtgctggctgaccagtac
ccggatgagaacgaggccttcgcattcgacgccatcgacaaggcgccggaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtacaacacccccaagcgccactacgcg
cacgtcgacgccccgggccacgccgactacatcaagaacatgattaccggcgccgctcag
atggacggtgcgatcctcgtcgtcgccgccaccgacggcccgatgccccagacccgcgag
cacgttctcctcgctcgccaggttggcgtcccctacatcctcgtcgccctgaacaagtgc
gacatggtcgacgacgaagagatcatcgagctcgtcgagatggaggtccgcgagcttctc
gctgagcaggactacgacgaggatgccccgatcatccacatctccgctctgggcgccctc
aacggcgagcagaagtgggtcgactccatcgtcgagctcatggctgcctgcgacgagtcc
atcccggacccggagcgcgccaccgatcagccgttcctcatgcccatcgaggacatcttc
accatcaccggccgtggcaccgtcgtcaccggtcgtgtcgagcgtggccagctgaaggtc
aacgaggaagtcgagatcatcggcatccaggagaaggcccagaagaccaccgtcaccggt
atcgagatgttccgcaagctgctcgactacaccgaggctggcgacaactgtggcctgctg
ctccgcggcattggccgtgaagacgtcgagcgtggccaggttgttgtcaagccgggcgct
tacaccccccacaagaacttcgagggttccgtctacgtcctgtccaaggacgagggcggc
cgccacacgccgttctttgacaactaccgcccgcagttctacttccgcaccaccgacgtc
accggcgtcgtcaagctgccggaaggcaccgagatggtcatgcccggcgacaacgtcgac
atctccgtcgagctgatccagccggtcgccatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgtcggtgctggccgcgtcaccaagatcctcgactaa

DBGET integrated database retrieval system