KEGG   Corynebacterium doosanense: CDOO_11975Help
Entry
CDOO_11975        CDS       T03413                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
cdo  Corynebacterium doosanense
Brite
KEGG Orthology (KO) [BR:cdo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdo01001]
    CDOO_11975
Enzymes [BR:cdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CDOO_11975
Protein kinases [BR:cdo01001]
 Serine/threonine kinases: Other
  Bacterial family
   CDOO_11975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR Pkinase Pkinase_Tyr TPR_19 APH RIO1
Motif
Other DBs
NCBI-ProteinID: AIT61896
UniProt: A0A097IIF4
LinkDB All DBs
Position
2394873..2397401
Genome map
AA seq 842 aa AA seqDB search
MSASTGKTGEDYGEEFVGTEAALFDPFADDEDFDDGENVVAEAVKYEPHAEQADHTTGSL
RRDAPDNPGTSAVAFDPFADDDEDEDDEELAGVGDIAGLIKDLGALRDHRTGRDGASRRE
DTAERARREALSTFRSRHGAERSSRPVADGMVELPFIAPARAEDALMDPHSEAKKPGIAM
PQLNPGDIVAEQYEILGVIGHGGMGWIYLAHDHFVADRLVVLKGMQAEKTDEEMAAARAE
REFLAGITHPQIVKIFNFIDDERVAGGFIVMEFVGGPSLRARRNAQDNHLLPIDVAIGYI
LEILPALDYLHSRGVVYNDLKPDNIIVTEDQVKLIDLGAVSGIGAYGYIYGTKGFQAPDV
STHGPSVATDIYTVGRTLATLTLDMPREDGIYLPGLPSPTTDPTLRRFLSYYRLLLRATH
PDPEQRFSSLAELETQLYGVLREVIALRDGRYHPQQHSLFSPQRSTFGTKHVVFRTDQLI
DGIDRTIRMTSDEVVSAIPTPLIDRSDVGAAMLSGSSYAEPQEALETLRQAMQTPEYEES
AEIPFGVVRAMLDLGLTSQARAWLQSLSERLGTDWRYQWYSGVTSMFLEDYQAAQSHFNQ
VLTILPGEPAPKLALAAVDELILQTRELQNTPLLDERVARATPALDGNLADLAREIFENF
PGDDLWSHVTDDPKLLRFHAMRLYGMVWASNPTTVSSAFGLSRLLVAEGLTEMAVQALDR
VPQASRHHRMAKLTTVLMLISDVLTESRIRRAARRLEEIPTNEPRFIQIKTAVMSAALEF
LQEAGVESAASHNTLFDYPFTQTGLRNGIANSLRRLARQAPSAQHRYALVDIANAVRPQT
LF
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccagcacgggaaagaccggagaggactacggcgaggagttcgtcggcacggag
gcggcgctgttcgaccccttcgcggacgacgaggacttcgacgacggggagaatgtcgtc
gccgaggccgtcaagtacgaaccccacgccgagcaggccgaccacaccaccggcagcctc
cggcgggacgcgccggataacccgggcacctcggccgtggccttcgaccccttcgcggac
gacgacgaggacgaggacgacgaggagctcgccggggtcggcgacatcgccgggctgatc
aaggacctcggggcgctgcgcgatcaccgcactggccgggacggggcgtcgagacgcgaa
gacaccgcagagcgtgcccgccgggaggcgctgtcgaccttccgttcccgccacggcgcc
gagcgcagctcccggccggtggccgacggcatggtcgagctgcccttcatcgccccggcg
cgcgcggaggacgcgctcatggacccacactccgaggcgaagaagccgggcatcgccatg
ccgcagctcaaccccggggacatcgtcgccgagcagtacgagatcctcggcgtcatcggc
cacggcggcatgggctggatctacctcgcgcacgaccacttcgtcgcggaccggctggtg
gtgctcaagggcatgcaggcggagaagacggacgaggagatggcggcggcgcgggcggag
cgggagtttctcgcggggatcacgcacccgcagatcgtgaagatcttcaacttcatcgac
gacgagcgcgtggccggcggcttcattgtcatggagttcgtcggcgggccgtcgctgcgc
gcgcgccgcaacgcccaggacaatcacctgctgcccatcgacgtggccatcggctacatt
ctggagattctcccggccctggactacttgcactcgcgcggggtggtctacaacgacctc
aaaccggacaacatcatcgtcaccgaggaccaggtcaaactcatcgacctcggcgccgtc
tccggcatcggggcctacggctacatctacggcaccaagggattccaggcccccgacgtg
tccacgcacgggccgtcggtggccacggacatctacacagtcgggcgcaccctggcgacg
ctgaccctggacatgccccgcgaggacggcatctacctccccggcctgccctcgcccacc
accgacccgacgctgcgccgtttcctctcctactaccgcctgctcctgcgggcgacgcac
ccggatcccgagcagcgcttctcctcgctggcggaactggagacccagctctacggcgtg
ctgagggaggtcatcgcgcttcgcgacggccgctaccacccccagcagcattcgctcttc
tccccgcagcgctcgacgttcggcaccaaacacgtcgtcttccgcaccgaccagctcatc
gacggcatcgaccggaccatccgcatgacctcggacgaggtcgtctccgccatccccacc
ccgctgatcgaccgctccgacgtcggcgcggccatgctctccggctcctcctacgcggag
cctcaggaagccctggagaccctgcgccaggcgatgcagaccccggagtacgaggagtcc
gcggaaatccccttcggcgtcgtccgcgccatgctcgatctggggctcacctcccaggcc
cgcgcctggctgcagtccctctccgaacgcctcggcaccgactggcgctaccagtggtat
tccggcgtgaccagcatgtttctcgaggactaccaggccgcccagtcccacttcaaccag
gtgctcaccatcctccccggcgagcccgcccccaaactcgccctcgcggccgtggacgaa
ctcatcctccagacccgggagctgcagaacaccccgcttctcgacgagcgggtcgcccgc
gccacccccgccctggacggcaacctcgccgacctcgccagggaaatcttcgagaatttc
cccggcgacgacctctggtcccacgtcacggacgaccccaagctcctgcgtttccacgcc
atgcgtctctacggcatggtgtgggcctccaaccccaccaccgtctccagcgccttcggc
ctctcccgactgctggtcgcggaggggctcaccgagatggcggtgcaggcactcgaccgg
gtgccccaggcatccaggcaccaccggatggccaaactcaccacggtgctcatgctcatt
tccgacgtgctcaccgagtcccggatcaggcgcgcggcccggcggctggaggagattccc
accaacgagccccggttcatccagatcaagaccgccgtcatgtccgccgccctggaattc
ctccaggaggcgggcgtcgagtcggcggcgagccacaacacgctcttcgactaccccttc
acgcagaccgggctgcgcaacggtatcgccaactcgttgcgacggctggcccggcaggca
ccctcagcacagcaccgctacgcgctggtggacatcgccaacgcggtgcggccgcagacg
ctgttctag

DBGET integrated database retrieval system