KEGG   Corynebacterium diphtheriae 241: CD241_1033Help
Entry
CD241_1033        CDS       T01687                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00620  Pyruvate metabolism
cdp00680  Methane metabolism
cdp01100  Metabolic pathways
cdp01120  Microbial metabolism in diverse environments
cdp01200  Carbon metabolism
Module
cdp_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cdp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CD241_1033 (ppc)
  Energy metabolism
   00680 Methane metabolism
    CD241_1033 (ppc)
Enzymes [BR:cdp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CD241_1033 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 WbqC
Motif
Other DBs
NCBI-ProteinID: AEX44098
LinkDB All DBs
Position
1054421..1057174
Genome map
AA seq 917 aa AA seqDB search
MGTLCIHHFCRKAELVTAAISDRVREDIRLLGRVLGRVIAQQEGEEVYELVEATRRMAFD
VSHGDADPEDLMVIFRDLDITKTNLVARAFSYFALLANLVEDLDDESVEADVSLRKTFAK
LKREGVSAADAASVIRSAEVAPVLTAHPTETRRRTVFDTQTRIKQLLKDAHHGGDMQVIE
QEMYLRMTLLWQTALIRIARPTLEDEIDVGLRYYKKSLLEQVPALNRSIRHSMRETFGLQ
LPDIAVMRPGSWIGGDHDGNPYVNARTLTYATRQAAKTVARYYVEQLGELERELSLSDRY
SSCSKELLALAEASGNNWESRVDEPYRRAVYGMRARMKSNVDALERPEKTAGKKSSKRTP
YATPEEFLRDLDVIDRSLRAHNDDVIADDRLARIRSAVTTFGFHLYTLDIRQNSESFEAV
IEEVFAAARRVPGGKRYSELAEAEKVELLIQELQTPRPLLFPGALEVEDAFSADTTKELG
IFLAAAQAVRDFGSRSIAHCIISMTATVSDILEPMVLLKEVGLRDVDVVPLFETIDDLRC
GAAILRELWSHPFYREHLRARGDIQEVMLGYSDSNKDGGYLQANWALYDAELGLVELCRE
HNIELRLAHGRGGAVGRGGGPTYDAILAQPKGAVSGSVRITEQGEVISAKYGAPETARRH
LEAFVSGALEASLLDTEPIADPDRAYAIMRDLAGFSGQRYQELVGDPGFIEYFTQSTPLH
EIGELNLGSRPAARKQTTAISDLRAIPWVLSWSQSRTNIPGWFGVGSAVSRFVSAVPEKD
RESRWQELRDLYATWPFFRSVMSNMAQVMAKAEISLARLYADLVDDPEVADRIYALIAEE
FELTRRAYLAITGNDALVSENQRQARSLKRRYPYLLPLNAIQLELLRRYRGGDDQFLVSK
TIQVTMNGLATALRNAG
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgggcacactttgtatccatcacttttgtaggaaggctgagctcgtgactgctgccatt
tctgatcgtgtccgtgaagatattcgattgctgggacgcgtactaggacgagttattgcg
cagcaagagggcgaagaagtctatgagctggtagaagctactagacgcatggcgtttgat
gtttctcatggtgacgctgatcctgaagatttaatggtgatttttagggatcttgatatc
actaagaccaaccttgttgctcgtgcttttagttattttgcgctgctggctaatttggtt
gaggatcttgatgatgaatccgtagaggcggatgtttcattgcgtaaaacttttgccaag
cttaagcgggagggggtgtctgcagctgatgctgcgagtgtgattcgtagtgctgaggtt
gcaccggtgcttacggcgcatcctacggagacgcgtcgtcgtacggtgtttgatactcag
actcggatcaagcagttgctcaaagacgcccatcatggtggggatatgcaggtcatcgag
caggaaatgtatctgcggatgacgctcttgtggcaaaccgcgctgattcgtattgcgcgt
ccaacgctggaggatgagatcgatgtggggttgcgctattacaagaagtcactcttggag
caggttcctgcgttgaatcgttcgatccgtcattctatgagggagacgtttggtctgcag
ctgccagatattgcggtgatgcgtcctggctcgtggattggtggcgatcacgatggtaat
ccgtatgttaatgctcgtaccttgacgtacgcgacgcgtcaggccgccaagacagtggcg
cgttattacgtggagcagttgggtgaactggaacgcgagctgtcgctgtctgatcgttat
tcttcgtgctccaaggagctgcttgcgttggccgaggcttcgggtaacaactgggaatcg
cgtgttgatgagccgtatcgtcgtgcagtctatgggatgcgcgcccgtatgaagtccaat
gtggacgctttggagcgtccggagaaaacagcggggaagaagtcgtcgaaacgcacgcct
tatgcaactcctgaggagttcttgcgcgatcttgatgtgattgatcgatcattgcgtgcg
cacaatgatgatgtgatcgctgatgatcggctagcgcgtatccgctcggctgtaaccact
tttgggttccatttgtacactctcgatatccgtcagaattctgagtcttttgaggctgtg
atcgaggaggtattcgcggcagcgcgtcgtgtacccggcggtaagcgttattcggagctt
gctgaggcagaaaaggttgagctgcttatccaggagctgcaaactccgcgtccgctgttg
ttccccggcgcgcttgaggtcgaggatgcgtttagcgctgataccactaaggaattgggg
attttcttagcggcggctcaggcggtgcgggatttcggatcgcggtcaattgcgcattgc
attatttcgatgacggctacggtgtccgacattttggagcctatggtgcttttgaaggaa
gtcggattgcgtgatgttgatgtggttccgctttttgagactatcgacgatcttcgctgc
ggtgctgctattttgcgcgagctgtggtcgcatccgttttatcgtgagcatcttcgtgcc
cgtggggatatccaagaggtgatgttggggtattccgattccaacaaggacggcgggtat
ctgcaagctaactgggcgttgtatgatgctgagctgggcttggtggagttgtgccgtgag
cacaatattgagttgcgtttggctcatggccgtggtggcgctgtgggccgtggtggtgga
cctacttacgatgcgattttggcgcagccgaagggtgcggtgtcgggttctgttcgtatt
acggagcagggtgaggtgatttctgcgaagtatggtgcgcctgagacggcgcgccgtcac
ttggaggcgtttgtttcgggggcgttggaggcgtcgcttctcgatactgagccgattgcg
gatccggatcgtgcgtatgcgattatgcgtgatcttgctggctttagtggtcagaggtat
caggagttggtgggagatcctgggtttattgagtacttcacgcagtcgactccattgcat
gagattggtgagcttaatctggggtcgcgtcctgctgcgcgtaagcaaacgacagctatt
tcagatcttcgtgctattccgtgggtgttgtcgtggtcgcagtcgcggaccaatattcct
ggttggtttggtgttggtagcgcggtgagccgttttgtatcggcggtgccggagaaggac
cgagagtcacggtggcaggagctgcgtgatttgtatgcaacgtggccatttttccgctcg
gtgatgtcaaatatggctcaggttatggccaaggcagagatctcgctggcaaggttgtat
gccgatttggtggatgatcccgaggttgctgaccggatttatgcgttgattgcagaagaa
tttgaacttacgcgtcgtgcatatttggctattactggtaatgatgcactggtgtcggaa
aaccagcgccaagcccgttcacttaagcggcgttacccgtatttgctaccgcttaacgcc
attcagctggagttgctgcggcgttatcgtggtggcgatgatcaattcttggtgtctaag
actattcaggtcaccatgaatggtttggccactgcgttgcgtaatgcggggtag

DBGET integrated database retrieval system