KEGG   Corynebacterium diphtheriae 241: CD241_1752Help
Entry
CD241_1752        CDS       T01687                                 

Gene name
fas
Definition
(GenBank) putative fatty acid synthase
  KO
K11533  fatty acid synthase, bacteria type [EC:2.3.1.-]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00061  Fatty acid biosynthesis
cdp01100  Metabolic pathways
cdp01212  Fatty acid metabolism
Module
cdp_M00082  Fatty acid biosynthesis, initiation
cdp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cdp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CD241_1752 (fas)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cdp01004]
    CD241_1752 (fas)
Enzymes [BR:cdp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     CD241_1752 (fas)
Lipid biosynthesis proteins [BR:cdp01004]
 Fatty acid synthase
  Bacteria type
   CD241_1752 (fas)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1729 Acyl_transf_1 ketoacyl-synt Ketoacyl-synt_C DNA_pol_B_N MaoC_dehydratas Fas_alpha_ACP SAT FAS_I_H DUF2937
Motif
Other DBs
NCBI-ProteinID: AEX44809
LinkDB All DBs
Position
complement(1849430..1858363)
Genome map
AA seq 2977 aa AA seqDB search
MTEHSIFTSHAAASRLIDNLEEQPFALVFSGQGFDWLETLRTSVEQGAARTLAPIIDEAA
EILKPAAGYLAPWQPQGFKPIEWARSESLALDTQAASLSVPGIVAAQLATLDQLEKQGLD
LDKSVASIGHSQGILGVMAHADLTRAAEILAISQLIGAAIARQGRITHMVVAGDARPMVS
IEGVTQQQLEDAIATAGVASEIGLRNARSTFVLVGTPADNQKVIEVLQAQAAASAREVEN
KLRGGRAFEPVIKPLDVEVAFHHSAMAPAVDVVVEMAAACGIDSERARKAAQAVIVTPVD
WPREVAQATSAGAQWLFDVGPNGGVVSLTNQAVVGQQVASFAVCGNEGQAALFDAGVAPE
LPVSFEKFAPRLVRRNGEVAVSTKFTQLTGLSPMLLAGMTPTTVDPEIVAAAANAGHWAE
LAGGGQVTPEILEGNIERLTQLLEPGMNAQFNSMFLDPYLWKMQVGGKRLVPKARAHGAP
INGIVITAGIPEHDEAVELVRELRDSGFPWVAFKPGAVKHVTKVLAIAREIPEIPVIIQV
EGGKAGGHHSWEELDELLIATYAQIRAVDNTVLCVGGGIGTPERAADYLTGQWSLAYDLP
AMPVDGILVGTAAMATKEAKTSAAVKQMLVDTKGSQDWVPAGGAVNGMASGRSQLGADIH
EIDNSFAKAGRLLDEVAGDADAVAKRREEIIAAIDKTAKPFFGDLDQMTYRAWLERYLEL
SGPYQGEWTDVSWHGRFVQMLHRAEARLSQQDHGSFAASVELGVDEDPYAAIAALATAYP
LIDQLVHPADAAWFLELARTPGKPVNFVPVIDKDIRRWWRSDSLWQSQDERYSADQVAII
PGIAAVAGIDRVDEPVADLLARFDAATVARLSGEQVCENTVRVVSRVLAASGTYWAGRHE
SNIVQRVGAPEQWEVSEDQKRATHPSGATLVELDEDHALLNVVLEGSTAPGTHAVLPIRI
TAPAKPGQAPAVTTADAEEAMGELTRIAAGGNLGEVAGDKVTSTTSIDRGHVADYEQVTG
SGPAPDILVGKAWPAIFAAVTQAKIPGTNDSVIEGMLSLVHLEHHITVVDHDLFAQICAS
EQPVDIDVTARAEDVSDTTIGRIVIVRAEMFVGTQLVAKLSERMAIRGRHGSAVARTNTS
ALPTVVDTPRSFRASATVTAPASMLPFAMVSGDRNPLHVSDVAAQLAGMSDGVIVHGMWT
SAMAELAASQDGSTVIEYTATMLAPVLPGQQVEFVVERSGVDSRPGAGEVREVTATVDGT
VVLTATAVMAAPTTFYGFPGQGIQHPGMGMDGFARSAAARAVWERADKHTRENLGFSIVE
IVKNNPEEVRVAGETFQHPKGVLFLTQFTQVAMATLGVAQIAEMKEAKALNQQALFAGHS
VGEYNALAAYAEVLSLENVVEIVYQRGLTMHRLVERDAEGNSNYGLAALRPDKMGLSEAE
VFDYVAQVSQASGEFLEIVNYNIAGKQYAVAGTSKGLRALAADAETRAPGKRAFIQIPGI
DVPFHSTHLLDGVGAFREHLDSLIPTEIDLSTLVGRYIPNLVARPFEVTREFIQAMLDVV
DAPILHAALENFDEEIRDEVRLARTLLVELLAWQFASPVRWIETQDLIIRGDVDRFVEVG
VGSSPTLANMLGQTLALPQYAGAHLEVLNVERDRPVVFATDELVREAPEVEVVAEPEVVS
AATAAAPTEAPVAAAPTQRPDDIDFSSADATEMLIALWTKVRPDQMGATDSIETLVEGVS
SRRNQLLLDLGVEFGLGAIDGAADAELTELKSTVSRMAKGYKAFGPVLGDAINDALRRLT
GPTGKRPNYVSERVANAWELGAGWGDHVTAAVVLGAREGASLRGGDLATLSPASPSNTAE
LDQLIDAAVQSVAQARGISVALPTAGGAGGSVVDSAALGEFAEHVTGEQGVLATTARTIL
SSLGLSASAGMDSLDEADADAALFDLVSQELGSDWPRQVAPAFDATKAVLLDDRWASARE
DIARAAVSGNTPEIDVTGLGEAVAAQAEYWGFDELARQARDTTPLRYADDIAVVTGASPR
SIAASVTAELLAEGATVVVTTSSLSHSRLAFYKDLYRSAARGSAALWIVPANLSSFADLD
ALIEWIGTEQTATVNGSSVLIKPALVPTVLFPFAAPRVSGSLADTSHQTEMQMRLLLWSV
EKLIAGLSKIGVNTHVGERLHVVLPGSPNRGRFGGDGAYGEAKAALDALVNRWSAENAWK
FDTSLVHILIGWVRGTGLMGGNDPLVAAVEAAGVTTYSTEEIAKVLVAQVEPEVRQRAAV
APVQVDYTGGLGTAELDLAELARNATLPHAESDDAEAGTKLKALPSLPHQLAAPAPDFAG
QVSQKLDDMVVIVGAAELGPYGSSRTRFEAETTGDLNAAGVLELAWTMGLIHWDEDPTPG
WYDADDQAIAEEDIFDRFHDEVLARVGVRRYHDDFGMVNNLAPELTTIYLDQDISFVVTD
KAAAKTFLESEPELTTVAHNPETGEWIVTRKAGSAVRVPRRMAMSRFVGGQIPEGFDPSV
YGIPADMVDNLDRVALWNLVCTVDAFLSSGFSPAELLAAIHPARVSSTQGTGLGGMESMR
SLYVDGLLAEPRQNDILQEALPNVMAAHVMQSYVGGYGQMIHPVAACATAAVSVEEGVDK
IKLGKSDFVVAGGFDDLSIEGITGFGDMAATADSAEMAAKGIEHRFFSRANDRRRGGFVE
AAGGGTVLLARGSLAADLGLPVHGVIGFAESFADGAHMSIPAPGLGALGAARGGKDSRLA
HQLAAVGVTADDISVLSKHDTSTTANDPNESDLHERLAKALGRTTGNPMFVVSQKSLTGH
AKGGAAAFQMIGLTQVLRSGVIPGNLALDCVDPVLREHKHLVWLRSAMQLGTAAKAGLVT
SLGFGHVSAIIAIVHPQAFVEALVAQRGSAQQWQEAAHAKEESGQRHLLKAMMGKATMYQ
RPVDRNLGNGGKELEAAVLLNDSARLVDGVYVVDPVA
NT seq 8934 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaacacagcatctttaccagccatgcggccgcctctaggttgatcgacaacctc
gaagagcaacccttcgccttggtattttccggtcaagggttcgactggctggaaacgttg
cgcacctctgttgagcagggcgccgcacgcactctcgccccgatcatcgacgaggccgct
gagatcctcaagcctgccgcagggtacttggctccgtggcagccacagggattcaagccg
attgagtgggctcgctcggagtcgctggcgttggatacgcaggcggcgtcgttaagcgtg
ccgggcattgtggccgcacagctggcaacgctggaccagctggaaaagcagggcttggac
ctggacaagtctgtggccagcattgggcattcgcagggcattttgggtgtgatggcccat
gcggatctcactcgcgcagccgaaatccttgcgatttcccagctcattggtgctgcgatt
gcacgtcagggccggatcacgcacatggtggtggcaggcgacgcgcgtccgatggtgtcg
atcgagggcgtaacccagcaacagctcgaggatgcgatcgctacggcgggtgtggcctcg
gagatcggtctgcgcaacgcgcgttccacgtttgtgctggttggtacgcctgctgataac
cagaaggtgattgaggttctgcaagcacaggctgcggcaagtgcccgcgaggttgagaat
aagctgcgtggtggtcgcgcgtttgagcctgtgattaagccgctggatgttgaggttgct
ttccatcattctgcgatggctcctgcggttgatgtggtcgtggagatggctgctgcgtgt
ggcattgattctgagcgtgcgcgtaaggcggcgcaggctgtgattgtgactcctgtggat
tggccgcgtgaggttgcgcaggcaacgtcggcgggtgcgcagtggcttttcgacgtcggc
ccgaacggtggcgtggtgtcgctgactaaccaggctgtggtggggcagcaggtggcgtcg
tttgcagtatgtggcaacgaggggcaggcggcgttgtttgatgcgggtgtggcccctgaa
ctgccggtttcttttgaaaaatttgcgccacggttggtgcgtcgtaacggtgaggtggcg
gtgtccaccaagttcacgcagctgacaggccttagccccatgttgctagcaggcatgacg
cctaccaccgtggatcctgagatcgtggcggcggcggccaatgcgggccactgggctgag
cttgctggtggcggccaggtcaccccagagattctggagggcaacattgagcgactaacg
cagctgcttgagcctggcatgaatgcgcagtttaactccatgttcttggatccgtacctg
tggaagatgcaggtgggcggtaagcgtcttgtgcctaaggctcgtgcccatggtgcaccg
attaatggcattgtgattactgcgggtatcccagagcacgatgaggctgtggagctggtg
cgtgagttgcgcgattctggtttcccgtgggtggcgtttaagcctggtgcggtcaagcat
gtgaccaaggtgttggctattgctcgtgagatcccagagattccggtgattattcaggtt
gagggcggtaaagcgggcggccaccattcgtgggaggagcttgatgagctgctgattgct
acgtatgcgcagatccgtgctgtggataacacggtgttgtgtgtcggtggtggtattggt
actccggagcgtgctgcggattatctcacgggtcagtggtcgttggcgtatgatctgccg
gctatgcctgtcgacggcatcttggtgggtactgcggcgatggctacgaaggaagcgaag
acttctgctgctgtaaagcagatgctggtggataccaagggctctcaggattgggttcct
gctggtggtgctgttaatggtatggcttcggggcgttcgcagctgggtgcggatattcac
gagattgataattcctttgccaaggctggccggttgttggatgaggttgctggcgatgcg
gatgcggtggcgaagcgtcgtgaggagatcattgcggcgatcgataagacggcgaagcca
tttttcggtgacctcgaccagatgacgtatcgcgcttggttggagcgctatcttgagctt
tctgggccgtaccagggcgagtggactgatgtgagctggcatggccgcttcgtgcagatg
ctgcaccgtgcggaggcgcggttgtcgcagcaggatcacggtagttttgccgccagcgtg
gagctgggtgtggatgaggatccatacgctgcgattgctgcgttggccacggcttatccg
ctgatcgatcagttggttcatccagcggatgcggcatggttcttggagcttgcccgtact
cctggcaagccggtgaattttgtgccggtgatcgataaggatattcgccgctggtggcgt
tcggattccttgtggcagtcgcaggatgagcgttatagcgctgatcaggtggctatcatt
cctggtattgctgcggttgcaggtattgatcgtgtggatgagccggttgcggatcttttg
gcgcgtttcgacgcagccaccgtggcgcgtctttccggcgagcaggtctgtgagaacacg
gtgcgtgtggtttctcgcgtgcttgcggcgagcggcacgtactgggctggccgccatgag
agcaatattgttcagcgcgttggtgcacctgagcagtgggaggtttccgaggatcagaag
cgtgctacgcatcccagtggtgctacgttggtggagctggatgaggatcatgcactgttg
aatgtggtgctggagggctctactgctccaggtacgcacgcggtgttgccgattcgtatt
acggcaccggctaagcctggtcaggctccggcggtgaccactgcggatgccgaggaggcg
atgggtgagctgactcgtatcgccgccggtggcaaccttggtgaggtcgcaggcgataag
gtgacctcgacgaccagcattgaccgtggtcatgttgcggactacgagcaggtaacaggt
tctggtccggcaccggacatcctggtgggcaaggcgtggcctgcgatttttgcggctgtg
actcaggcgaagatccctggcacaaatgactcggtgatcgagggcatgttgtcgctggtc
cacttggagcaccacatcacggtggtcgatcatgacctgtttgcgcagatctgtgcaagt
gaacagccggtggatattgatgtgaccgctcgtgcagaagacgtcagcgacaccaccatt
ggtcgtatcgtgatcgtgcgcgcggagatgttcgtcggcacgcagctggtggcaaagctg
agcgagcgcatggctattcgcggccgccatggttctgctgtggcacgcacgaacacatcc
gccctgcctactgtggtggataccccacggtcgttccgtgcgagtgccacggttaccgca
cccgcgtcgatgttgccatttgcgatggtgtcgggggatcgcaacccactgcacgtctct
gatgttgccgcccaactggcaggtatgagcgatggtgtgatcgtgcacggcatgtggacg
tctgccatggcggagcttgccgctagccaagacggcagcacggtaatcgagtacaccgcc
accatgttggcgccggtactgcctggccagcaggtggagtttgttgtcgagcgcagtggc
gtggatagtcgcccaggcgctggcgaggtccgcgaggtgaccgcaacagtcgacggcacc
gtggttcttactgctaccgcggtgatggccgcaccgaccacgttctatggtttcccaggt
cagggtattcaacacccaggcatgggcatggatggatttgcgcgttctgccgcagcgcgt
gcggtgtgggagcgtgccgataagcacacccgcgagaatctgggattctccattgtggag
atcgtgaagaacaaccccgaagaggttcgcgttgctggggagacgttccagcaccccaag
ggtgtgctgttcctcacccagttcacccaagtggcaatggctacccttggcgttgcccag
atcgctgagatgaaagaagcgaaggcgcttaaccaacaggcactgtttgctggccactcg
gtgggcgaatacaacgccttggctgcctatgctgaggtgctttcgctagaaaacgtggtg
gagatcgtctaccagcgcggattgaccatgcaccgccttgtggagcgcgacgccgagggc
aactccaactacggtctagcagcccttcgccccgacaagatggggctcagcgaggcagaa
gtctttgactacgtagcccaggtttcccaagcaagtggcgagttcttggagatcgtcaac
tacaacattgccggcaagcagtatgcggtggcgggaacgtcgaaaggcctgcgtgccttg
gctgcggatgcggaaacccgcgcgccgggtaagcgtgcctttatccagatccctggtatt
gacgtgccgttccactccacgcatttgttggacggtgtgggtgcgttccgtgagcatttg
gactcgctgatcccaacagagattgatttgagcacgctggtaggccgctatattccgaac
ttggtggcgcgcccgttcgaggtgactcgcgagtttatccaggcgatgcttgatgttgtg
gacgctccaattttgcatgctgcgttggagaactttgatgaggagatccgcgatgaggtc
cgcttggcgcgcaccttattggttgagctgttggcgtggcagtttgcgtcgccggtgcgc
tggattgaaacccaggatttgattatccgcggcgatgtggatcgctttgtggaggtcggc
gtgggttcctcgccaacccttgcgaacatgttgggtcaaacgttggcgttgccacagtat
gcgggcgctcaccttgaggtgttgaatgttgagcgcgatcgtccggtggtgtttgctacc
gatgagttggtgcgcgaggcccctgaggtcgaggtagttgcggagccggaggtggtgtct
gctgcgacggcggctgctcctacggaggctccggtggcggctgcgccgacgcagcgtccg
gatgatattgatttctcgtctgcggatgcgactgagatgttgattgcgttgtggactaag
gttcgccctgatcagatgggtgcgacggattcgattgagacgctggtggagggtgtgtct
tcgcgccgtaaccagttgttgttggatctgggtgtggagttcggcttgggcgctattgat
ggcgctgctgacgcggagctcacggagttgaagtccacggtgtcgcggatggcgaagggc
tacaaggcgttcggtccggtgttaggcgatgcgatcaatgatgcgttgcgacgtctcacc
ggccctacgggtaagcgtcctaattatgtttcggagcgcgtggctaacgcgtgggagctt
ggtgctggttggggcgatcacgtgaccgctgctgtggtgttgggtgcgcgcgagggggcg
tcgttacgcggcggggacctagcaacgttgagccctgcgtcgccgtcgaataccgctgag
ctggatcagttgatcgatgctgcggtgcagtcggttgctcaggcgcgcggcatttcggtg
gcgttgccaactgccggtggcgcgggtggatccgtggtggattcggcggcactgggcgag
ttcgcggagcacgttactggcgagcagggtgtgttggctactacggcgcgcacgattttg
agctccttgggattgtcggcttctgctggcatggattccttggacgaggcggacgcggat
gcggccctgtttgatttggtgtcgcaggagttgggttcggactggccacgccaggttgcc
ccagcgtttgatgcgaccaaggcggtgcttctcgacgaccgttgggctagcgctcgtgaa
gatattgctcgcgctgcggtgtcgggtaacacccccgagattgatgtgactggtcttggc
gaggccgttgccgcccaggcggagtactggggctttgatgagctggcacgtcaggcacgc
gataccacaccattgcgctacgcggatgacattgcggtggtcacgggcgcttcgcctcgt
tcgattgcggcctcagtgactgccgagctgctggcagaaggtgccaccgtggtggttact
acctccagcctgagccattctcgtttggcgttttataaggatctgtatcgttcggctgct
cgtggcagcgcggcgttgtggatcgttcctgcgaacctgtcctcgtttgctgatctcgat
gcgttgatcgagtggattggtacggaacaaaccgccaccgttaacggcagcagtgtgctg
attaagccagctctggttcctaccgtgctgttcccattcgcggcaccgcgcgtgagcggt
tccctggcagataccagccaccagacggaaatgcagatgcgcttgctgttgtggtcggta
gaaaagctcatcgctgggctgtccaagattggtgtgaacacccatgtgggcgagcgcctg
cacgtggtgttgccaggttctcctaaccgtggccgcttcggtggcgacggtgcctatggt
gaggccaaggccgcactggatgcgctagtcaaccgctggagtgcagaaaacgcgtggaag
tttgatacctcgctggtccatatcttgatcggttgggtgcgtggcaccggtttgatgggc
ggcaacgatccgctcgtggcagcggttgaggctgcgggtgtgaccacctactccacggag
gagatcgctaaggtgctggtggcgcaggttgagcctgaggttcgtcagcgtgccgcggtt
gccccagttcaggtggattacaccggtggtttgggcacggctgagcttgatcttgcggag
ttggcacgcaatgccacgctgccgcacgcagaaagtgatgatgccgaggctggcacgaag
ctcaaggcgttgccgtcgctacctcaccagctggcagcacctgcaccagattttgcgggg
caggtgtcgcagaaactcgatgacatggtcgtgatcgtcggcgctgcagagcttgggcct
tatggttcctcgcgcacccgctttgaggcagaaaccaccggcgatctgaatgccgctggt
gtgcttgagttggcgtggaccatgggacttattcactgggatgaggacccaaccccaggt
tggtacgacgctgatgaccaagcgattgcagaagaagacatctttgatcgcttccacgac
gaagtattagcccgcgtgggcgtgcgccgctaccacgacgacttcggcatggtaaataac
ctcgcaccagagctgaccacgatctatttggatcaagacatcagctttgtggtcaccgat
aaggccgctgccaagacgttcttggagtccgagccagaactgaccacggtggcacacaac
ccagaaactggggagtggattgttacccgtaaggcaggctcggcggtacgcgtgccgcgt
cgtatggcgatgagccgttttgtgggcggccagattccagaaggatttgatccttcggtc
tatggaatcccggccgacatggtggacaacttggatcgcgtggcactgtggaacctcgtg
tgcacggtggatgcgttcttaagctccggatttagcccagctgagttgttggcggcgatc
caccccgctcgtgtttcttccacccaaggcactggccttggtggcatggaatccatgcgt
tcgctctatgtggacggcctgcttgccgagccacgccaaaacgacatcctgcaggaagcg
ctgcccaacgtgatggctgcgcacgtgatgcagtcttatgttggtggctacggccagatg
atccacccggttgccgcgtgtgctactgctgcggtgtcggtggaagagggcgtagacaag
atcaagctgggcaagtccgactttgtggtcgccggtggttttgatgatctttccatcgag
ggcattactggcttcggtgacatggcggctacggcggattctgcagaaatggctgctaag
ggcattgagcatcgcttcttctctcgtgcgaatgaccgccgtcgcggtgggttcgtagaa
gctgctggtggcggcaccgtgctgttggcacgtggctcgcttgccgcagatttgggtcta
ccggttcacggtgtgattggctttgcggagtccttcgctgatggtgcacacatgtcgatc
ccagcgcctggtctcggtgcgttgggtgcagcacgcggtggcaaggattcccggttggct
catcagctggcagcggtgggtgtgactgcggatgacatctcggtgttgtctaagcacgac
acctccaccactgcgaatgatccgaacgagtcggatctgcacgagcgtcttgccaaggca
ttgggccgtaccacgggcaatcccatgtttgtggtgtcgcagaagtcgctgactggccat
gcgaagggtggcgctgctgccttccagatgatcgggcttacccaggtgctgcgcagcggt
gtgattcctggcaaccttgcactcgattgtgtggatccggtgttgcgtgagcacaagcac
ttggtgtggttacgcagcgctatgcagctaggaactgccgccaaggctggtttggtcacc
tcgctgggctttggccacgtgtcggcgatcatcgcgatcgtgcacccacaggcgtttgtg
gaggctttggttgcgcagcgcggtagtgcgcagcagtggcaggaggcagcccatgccaag
gaggaaagcggccagcgtcatctgctcaaggcgatgatgggcaaagccaccatgtaccag
cgtccggtggatcgcaaccttggcaatggcggtaaggaactagaagcagcggtgctgctg
aatgattccgcccgcttggttgacggtgtgtatgtggttgatccagtagcctaa

DBGET integrated database retrieval system