KEGG   Corynebacterium diphtheriae 241: CD241_2127Help
Entry
CD241_2127        CDS       T01687                                 

Gene name
glpD
Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cdp  Corynebacterium diphtheriae 241
Pathway
cdp00564  Glycerophospholipid metabolism
cdp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CD241_2127 (glpD)
Enzymes [BR:cdp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CD241_2127 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Thi4 Pyr_redox_2 GIDA 3HCDH_N HI0933_like
Motif
Other DBs
NCBI-ProteinID: AEX45179
LinkDB All DBs
Position
complement(2269127..2270851)
Genome map
AA seq 574 aa AA seqDB search
MTTKSHCTFNPDYYQDVWQRFGEEEYDVVVIGGGSVGAGAGLDAAIRGLKVAVVESRDFA
AGTSSRSSKMFHGGLRYLAMLDFKLVAESLHERELNMSTLAPHLVKPLKFLFPLTHHVWE
RVMMFGGFTLYDLMGGAKSVPMQKHYSRKGTLAMAPGLKDDAVVGSVRYFDTLVDDARHT
MTVLRTAGELGADVRPSTQVVGFEKDGQRVVGAILQDTDNGEQTTIRGKVFINATGVWND
HIEKLAGGNGPFSVHASKGVHIVVPKNVFDADAAMCFVTEKSVLFVIPWGEYWIIGTTDT
DWDLNRADPAPTAADINYILDEVNQRVRRPIQHSDIVGVYSGLRPLLSGKSDTTTKLSRN
HAVAKVMPGLVSVAGGKYTTYRVIGKDAVDLAAEDLDFRVPASESERTPILGADGYHALQ
NQAPRIARTFGTTEDVVEHLLGRYGSLVHEVLEPSVDKPELLEPIPGAPGYIKAEAVYAV
THEGALHVEDIVERRLRAGIEYADRGVAAAPAIAELVADYLGWDAERTAAEVTAFTDRVS
AEIAAEKELTDKAANEHIVAGSAVRSYVDVSGDN
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaaatcccattgcacattcaaccccgactactaccaggacgtctggcagcgc
ttcggtgaagaagaatacgacgttgtcgtcatcggtggcggctccgtcggcgcaggcgca
ggcctcgacgcagcaatccgcggcctcaaagtggccgtcgtagagtcccgagacttcgca
gccggcacctcctcacgatcatcaaaaatgttccacggtggcctgcgatatctcgccatg
ctggacttcaagctggtggccgaatccctccacgagcgcgaactcaacatgtccacgctc
gcaccgcacctggtcaagccgctgaaattcctcttccccctcacacaccacgtgtgggaa
cgggtgatgatgttcggcggctttactctttacgacctcatgggcggcgcaaaatcagtc
cccatgcaaaagcactactcccgcaagggaacactcgccatggccccaggactaaaagac
gacgctgtggtcggatccgtccgctactttgacacgcttgtcgacgacgcccgccacacc
atgacagtcctacgcaccgccggcgaactcggcgcagatgttcgcccctccacccaagta
gtcggctttgaaaaagacggccaacgtgtggtcggcgccatcctccaagacaccgacaac
ggcgaacaaaccaccattcgcggcaaggtattcatcaacgccaccggcgtatggaacgac
cacattgaaaagctcgccggcggcaacggccccttctcggtccacgcctccaagggtgta
cacatcgtggtaccaaagaacgtcttcgatgccgacgcagccatgtgctttgtcaccgaa
aagtccgtgcttttcgtgatcccatggggtgaatactggatcatcggcaccaccgacacc
gactgggacctcaaccgcgcagaccccgcaccaactgccgccgacatcaactacatcctc
gacgaggtaaaccagcgagtccgccggcccatccaacactccgacatcgtcggcgtgtac
tccggactccgcccgctgctctccggcaaatccgacaccaccaccaagctgtcgcgcaac
cacgccgtagcaaaggtcatgccaggactcgtctccgtcgccggcggtaagtacaccacc
taccgtgtgatcggcaaggatgcagtcgacctcgccgccgaagacttggacttccgcgta
ccagcctccgaatcggaacgcaccccgatcctcggtgccgacggctaccacgccctacaa
aaccaagcaccgcgcatcgcccgcaccttcggcaccacagaggacgtcgtcgagcacctg
ctcggccgctatggctccctcgtccatgaggtcctagaaccgagcgtcgataaacctgag
ctgctcgaacccatcccaggcgcgccgggctacatcaaagcagaggccgtctatgccgtc
acccacgagggtgccctgcacgtcgaggacatcgtggaacgtcgcctacgtgccggcatc
gaatacgccgaccgtggcgttgccgcagctcccgccatcgccgagctcgttgccgactac
cttggctgggacgccgagcgcaccgccgccgaggtcaccgcgttcaccgaccgcgtgtcc
gccgaaatcgccgccgagaaggagctcactgacaaagccgccaacgagcacatcgtggca
ggctccgcggtgcgcagctatgtggatgtgtcaggtgataactaa

DBGET integrated database retrieval system