KEGG   Chelatococcus daeguensis: BOQ54_01295Help
Entry
BOQ54_01295       CDS       T04583                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cdq  Chelatococcus daeguensis
Pathway
cdq00564  Glycerophospholipid metabolism
cdq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cdq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BOQ54_01295
Enzymes [BR:cdq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BOQ54_01295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 FAD_binding_2 FAD_oxidored GIDA NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: APF36134
LinkDB All DBs
Position
complement(291666..293186)
Genome map
AA seq 506 aa AA seqDB search
MQEKVFDLAIIGGGVNGCGIARDAAGRGLSTILFEQNDLASATSSASTKLIHGGLRYLEY
YEFRLVREALMEREVLWKLAPHIIRPLRFVLPHHAGLRPAWMLRLGLFLYDHIGGRKLLP
ATRRLDLRHDPAGRPLKGGYATAFEYSDCWVEDARLVVLNARDAAERGAAIHPRTRVIGA
ERRTDHWLVTAERRSDGARMTAKARMLVNAAGPWVADVLAGIVREKAPAGVRLVQGSHIV
LPKLFDHDRCYIFQNSDGRIVFAIPYEHDFTLIGTTDRDYRGDPAAVRASEEEIGYLCAA
ASEYFAKPVRREDVVWTYSGVRPLYDDGASKAQEATRDYVLKREGEGNEPFLLSVFGGKI
TTYRRLAEAVLDKLAPQLPEAARAKAGWTAGAPLPGGDFPHDGYDALTRRIAGEHPYLGG
GIAARLARAYGTRAFAILEGARAMADLGRQFGAGLSEREVDYLMREEWAMTAEDVLWRRS
KLGLRLTREEAAALDDFMAARLRQAA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagagaaggtcttcgacctcgccatcatcggagggggcgtcaacggctgcggcatc
gcgcgcgatgcggccgggcgggggctttcgaccatcctcttcgagcagaacgaccttgcc
agcgccacctcctccgcttccaccaagctcattcacggcggcctgcgctatctcgaatat
tacgagttccgcctggtgcgcgaggcgctgatggagcgcgaggtgctgtggaagctcgcg
ccccacatcatccggccgctgcgcttcgtgctgccgcaccatgccgggctgcgccccgcc
tggatgctgcgcctcggcctcttcctctacgaccatatcggcggccgcaagctgctgccg
gcgacgcgccgcctcgacctgcgccacgatccggccggccggccgctcaagggcggctat
gccaccgccttcgaatattccgactgctgggtggaggacgcgcgcctcgtcgtgctcaat
gcccgcgacgcggccgagcgcggcgccgccatccacccgcgcacgcgcgtcatcggcgcc
gagcggcgcaccgaccattggctcgtcaccgccgagcggcgcagcgacggcgcccggatg
acggcgaaggcccgcatgctggtcaatgccgccggcccctgggtggccgacgtgctggcc
ggcatcgtgcgcgagaaggccccggcgggcgtacgcctcgtgcagggcagccacatcgtc
ctgccgaagctcttcgatcacgaccgctgctacatttttcagaacagcgacggccgcatc
gtcttcgccatcccttacgagcacgacttcacgctcatcggtacgacggatcgcgactat
cgcggcgaccccgccgccgtcagggcgagcgaggaggagatcggctatctctgtgccgcc
gcgagcgaatatttcgccaaacccgtgcggcgcgaggacgtggtgtggacctattcgggc
gtgcgaccgctctacgacgacggcgcctccaaggctcaggaggcgacgcgcgactacgta
ctcaagcgcgagggcgagggaaacgaacccttcctcctctccgtcttcggcggcaagatc
accacctaccgccggctcgccgaggccgtgctcgacaagcttgcgccgcaactgcccgag
gcggcgcgggccaaggccgggtggacggcgggtgcgccgctgccgggcggagatttcccg
catgacggctacgacgcgctgacccgccgcatcgcgggcgagcatccctatctcggcggt
ggcatcgcggcgcgccttgctcgagcttacggcacgcgggccttcgccatcctcgagggg
gcccgcgccatggcagacctcggccgccagttcggcgccggtctcagcgagcgcgaggtg
gactatctcatgcgcgaggaatgggcgatgacagccgaggacgtcctgtggcgccgctcc
aagctcggtctgcgcctgacccgggaggaggcggccgcgctcgacgatttcatggccgcg
cggctcaggcaagcggcctga

DBGET integrated database retrieval system