KEGG   Chelatococcus daeguensis: BOQ54_02955Help
Entry
BOQ54_02955       CDS       T04583                                 

Gene name
dppD
Definition
(GenBank) dipeptide ABC transporter ATP-binding protein DppD
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
cdq  Chelatococcus daeguensis
Pathway
cdq02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cdq00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BOQ54_02955 (dppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cdq02000]
    BOQ54_02955 (dppD)
Transporters [BR:cdq02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    BOQ54_02955 (dppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_22 AAA_29 AAA_16 CbiA DUF87 ATP-synt_ab AAA_25
Motif
Other DBs
NCBI-ProteinID: APF36404
LinkDB All DBs
Position
complement(640331..641380)
Genome map
AA seq 349 aa AA seqDB search
MAAVLSAPSPLTATLPEDVVLRAEDLHTHFIVGERAAKSVDGVTLTVRRGETLAVVGESG
SGKSVTSLSIMRLLAHPGRIVAGKILYRMRDGTVVDLATLPEKRMRAIRGKEIAMIFQEP
MTSLNPLYTVGDQIMEMIRLHEPLSRHEARRRARQMLELVEIPAAEKRLDQYPHEMSGGM
RQRVMIALALSCNPALLIADEPTTALDVTIQAQILDLMRRLQRDIGMSILFITHNLGVVA
EIAHEVAVMYAGRVVEQAPVEALFARPRHPYTKGLLACIPNPERDRAADGARLMLNPIPG
NVPSVLNLPPGCTYAPRCPLVEPHCEREAPGLVPAGPGHLSRCFRHELL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtcctttccgccccctccccgctcaccgcgacgctacccgaggacgtcgtc
ctcagggccgaggacctgcacacccacttcatcgtcggcgagcgcgcggcgaagtccgtc
gacggcgtgacgctgacggtgcgccggggcgaaacgctcgccgtcgtcggcgaatctggc
tcgggcaagtcggtgacgagcctgtcgatcatgcgcctcctcgcccatcccggccgcatc
gtcgcagggaaaatcctctaccggatgcgcgacggcacggtcgtcgatctcgcgaccttg
ccggaaaagcgcatgcgcgccatccgcggcaaggagatcgccatgatcttccaggagccg
atgacgagcctcaacccgctctacaccgtcggcgaccagatcatggaaatgatccgcctg
cacgagccgctttcccggcacgaggcgcgccggcgggcgcggcagatgctcgagcttgtc
gagatcccggcggccgagaagcggctcgaccaatatccgcacgagatgtcggggggcatg
cgccagcgcgtgatgatcgcgctcgcgctctcgtgcaacccggccctcctcattgccgac
gagccgacgacggcgctcgacgtcaccatccaggcccagatcctcgacctgatgcgccgc
ctgcagcgcgacatcggcatgagcatcctgttcatcacccacaatctcggcgtcgtcgcc
gagattgcccacgaggtggcggtgatgtatgccggccgcgtggtcgagcaggccccggtc
gaggcgctcttcgcgcggccgcgccacccctataccaagggcctcctcgcctgcatcccc
aacccggagcgcgaccgggcggcggacggggcgcggctgatgttgaaccccatccccggc
aacgtcccgagcgtgctcaacctgccgccgggctgcacctatgcgccgcgctgcccgctc
gtcgagccacactgcgagcgcgaggcgccgggcctcgtgccggccggccccggccacctc
tcccgctgcttcaggcacgagttgctgtga

DBGET integrated database retrieval system