KEGG   Chelatococcus daeguensis: BOQ54_05085Help
Entry
BOQ54_05085       CDS       T04583                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cdq  Chelatococcus daeguensis
Pathway
cdq00970  Aminoacyl-tRNA biosynthesis
cdq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BOQ54_05085
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cdq03029]
    BOQ54_05085
Enzymes [BR:cdq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BOQ54_05085
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BOQ54_05085
Mitochondrial biogenesis [BR:cdq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BOQ54_05085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: APF36774
LinkDB All DBs
Position
1080946..1082289
Genome map
AA seq 447 aa AA seqDB search
MAHQTLTDIAADLASGRTDPVRLVEEALDKARAAPAVFITLMAEEALAEACAAAARRRNG
KALGPLDGIPIAWKDLFDIAGTRTTAGSRTRDDAPMAREDAPVVAASRRVGLIPLGKTNL
SEFAFSGLGPNPHFGTPTPDFPGVAPRVPGGSSSGSAVAVQRGIVPVGIGTDTAGSVRVP
AALNGLVGFKASGGRYAMAGVYPLAKSLDSLGPIARTVADCVTIDAVMRGTGRVAEAASA
APDIVVDPAVLEEDGLEDAVRANFEAMLAGLEASGARVRRAPVAAWREARRAIAEIGWLG
AVEARAWHLDAISGPKRDLIDARVLKRLDGAAAITAEAAGRLRSLKATLSRSIADDLAGA
LFALPTVKHVAPELASLEADPELFARINLATLTLTMAGSFLDMPGLALPSGTNAEGLPTS
ALFSLPSGDDDALLAAGLWIEHAIARH
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggctcatcagactttgaccgacatcgcggctgaccttgcgtcgggccggacggatccc
gtgcgcctcgtcgaggaggcgctcgacaaggcccgcgcggcccccgccgttttcatcacc
ctcatggccgaggaggcgctggccgaggcctgcgccgccgccgcgcgccggcgcaacggc
aaggcgctcggcccgctcgacggcatcccgatcgcctggaaggacctcttcgacatcgcc
ggtacgcggacgaccgcgggctcgcgcacacgggacgatgcgcccatggcccgcgaggac
gcgccggtcgttgcagcgtcgcggcgcgtcggcctcatcccgctcggcaagaccaatctc
agcgagtttgccttttccggcctcggcccgaacccgcatttcggcacgccgacgccggac
ttcccgggggtggccccccgcgtgcccggcggctcgtcctccggctcggcggtcgccgtc
cagcgcggcatcgttcccgtcggcatcggaacggataccgccggctcagtacgggtgcct
gccgccctcaacggtcttgtcggcttcaaggcgtcgggcgggcgctatgccatggccggt
gtctatccgctggcgaagagtctcgacagcctcgggcccatcgcccgaacggttgccgat
tgtgtgaccatcgacgcggtgatgcggggtaccgggcgagttgccgaagccgcatcggcc
gcacccgacattgtcgtcgacccggcggtgctggaggaggacggcctcgaagatgcagtg
cgggccaatttcgaagcgatgctcgctggtctcgaagcatcgggcgctcgcgtgcgccgc
gcgccggtggctgcctggcgcgaggcacggcgtgccatcgccgagatcggctggctcggc
gcggtggaggcgcgcgcctggcatctcgatgcgatcagcggtccaaagcgcgacctcatc
gatgcgcgtgtgctgaagcggctcgacggtgcggcggcgatcaccgccgaggcggccgga
cgtctgcgtagcctcaaggccacgctgtcgcgctccatcgccgacgatctcgccggcgcg
ctgttcgcgctcccgaccgtcaagcatgtggcgccggagctcgcgtcgctcgaagccgac
cccgaactgtttgcccgcatcaatctcgccacgctcacgctgacgatggccggcagcttc
ctggacatgcctggtcttgccctgccgtccggcaccaatgcagagggcctgccgacctcc
gccctgttctcgctcccgtccggcgatgacgacgctcttctcgccgcgggattgtggatc
gagcatgccatcgcaaggcactga

DBGET integrated database retrieval system