KEGG   Chelatococcus daeguensis: BOQ54_06175Help
Entry
BOQ54_06175       CDS       T04583                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cdq  Chelatococcus daeguensis
Pathway
cdq00061  Fatty acid biosynthesis
cdq00780  Biotin metabolism
cdq01100  Metabolic pathways
cdq01130  Biosynthesis of antibiotics
cdq01212  Fatty acid metabolism
Module
cdq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cdq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BOQ54_06175
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BOQ54_06175
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BOQ54_06175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cdq01004]
    BOQ54_06175
Enzymes [BR:cdq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BOQ54_06175
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BOQ54_06175
Lipid biosynthesis proteins [BR:cdq01004]
 Fatty acid synthase
  Component type
   BOQ54_06175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: APF36965
LinkDB All DBs
Position
1301355..1302185
Genome map
AA seq 276 aa AA seqDB search
MADNSATRPSIMSGKRGLIMGVANNRSIAWGIAKAAHAHGAELAFTYQGDALKKRVEPLA
AELGAEVIGHCDVTDGATIDAVFAEVEKRWGKLDFLVHAIAFSDKDELTGRYVDTSQENF
SKSLLISCYSLTAVAQRAEKLMTDGGSLLTLTYYGAEKWMPHYNVMGVAKAALEASVRYL
AADLGPQGIRVNAISAGPIKTLAASGIGDFRYILKWNEYNSPLRRTVTIEEVGETAAYLL
SDMSRGVTGEIHHVDAGYHVVGMKNPDAPDIVLGKE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaactcagcgacacgcccgtccatcatgtccggcaagcgcgggctcatcatg
ggagtggccaacaaccgctccattgcctggggcattgccaaggccgcgcacgcccatggg
gccgaactcgccttcacctaccagggcgatgcgttgaaaaagcgcgtcgagccgcttgcg
gcggagctcggcgccgaggtcatcgggcattgcgacgtcaccgacggggcgaccatcgat
gctgtcttcgcagaagtggagaagcgctggggcaagctcgacttcctcgtccatgccatc
gctttctcagacaaggacgagcttaccggtcgctacgtcgatacgagccaggagaacttt
tccaagagcctgctgatctcctgctactcgctgacggccgtcgcccagcgcgccgagaag
ctgatgacggacggcggctccctgctgacgctgacctattacggcgccgagaagtggatg
ccgcactacaatgtcatgggcgtcgccaaggcggcgctcgaggcaagtgtgcgctatctc
gcggccgacctcggcccgcagggcatccgcgtcaacgccatctctgccgggccgatcaag
acgctcgccgcctcgggcatcggcgacttccgctacatcctcaagtggaacgagtacaac
tcgcctctgcgccgcacggtgaccatcgaggaagtgggcgagacggcggcttatctcctg
tccgacatgtcgcgcggcgtgaccggcgagattcaccatgtcgatgccggctatcatgtc
gtcggcatgaagaaccccgacgcgcccgacatcgtgctcggcaaggaatga

DBGET integrated database retrieval system