KEGG   Chelatococcus daeguensis: BOQ54_08710Help
Entry
BOQ54_08710       CDS       T04583                                 

Definition
(GenBank) zinc-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cdq  Chelatococcus daeguensis
Pathway
cdq00010  Glycolysis / Gluconeogenesis
cdq00071  Fatty acid degradation
cdq00350  Tyrosine metabolism
cdq00625  Chloroalkane and chloroalkene degradation
cdq00626  Naphthalene degradation
cdq01100  Metabolic pathways
cdq01110  Biosynthesis of secondary metabolites
cdq01120  Microbial metabolism in diverse environments
cdq01130  Biosynthesis of antibiotics
cdq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cdq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BOQ54_08710
  Lipid metabolism
   00071 Fatty acid degradation
    BOQ54_08710
  Amino acid metabolism
   00350 Tyrosine metabolism
    BOQ54_08710
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BOQ54_08710
   00626 Naphthalene degradation
    BOQ54_08710
Enzymes [BR:cdq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BOQ54_08710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Glu_dehyd_C Ribul_P_3_epim Methyltransf_25 adh_short
Motif
Other DBs
NCBI-ProteinID: APF37400
LinkDB All DBs
Position
complement(1838982..1840004)
Genome map
AA seq 340 aa AA seqDB search
MPKMKAAIARVFGEPLAIEEWTVPEPRPDQILVKIAATGVCHTDLHAVKGDWPVKPTLPF
IPGHEGVGTVAAVGRDVKRVKEGDRVGVPWLHTACGYCPHCRTGWETLCGSQQNTGYSVN
GSFAEYALADPNYVGRLPENLAWGPAAPVLCAGVTVYKGLKETEVKPGEWVAISGIGGLG
HMAVQYARAMGMHVAAIDVHPDKLELARSLGAEIAIDARERDPVSELQQRIGGVHGVLVT
AVSPAAFEQAFGVLRPHGTMALVGLPPGRFAMPIFDTVLKRITVRGSIVGTRQDLEEALA
FAGDGAVAAHFSWDRLDNINDVFERMEAGAIDGRVVLDLA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagatgaaagccgccatagcgcgggtgttcggcgagcctctcgccatcgaggaa
tggacggtgccggagccgcggccggaccagatcctcgtcaagatcgcggcgacgggcgtc
tgccacaccgacctgcacgcggtgaagggcgactggccggtcaagccgacgcttccgttc
attcctggccacgagggcgtgggcacggttgccgctgtggggcgcgacgtgaagcgcgtg
aaggagggcgaccgtgtcggcgtgccctggctgcacacggcctgcggctactgcccccat
tgccgcaccggctgggagacgctatgcggcagccagcagaacaccggctattccgtcaac
ggcagcttcgccgaatatgccctcgctgacccgaactacgtcggccggctgcctgaaaac
ctcgcctggggaccggccgcgccggtgctctgcgccggggttaccgtctacaagggcctc
aaggagacggaggtgaagcccggcgaatgggtggcgatctccggcatcggcgggctcggc
cacatggccgtgcaatatgcgcgcgccatgggcatgcatgtcgccgccatcgacgtgcat
cccgacaagctggaactcgccaggtcgctgggcgcggagattgccatcgacgcccgcgag
cgcgaccctgtttcggagctgcagcagcgcatcggcggcgtgcatggtgtcctcgtgacg
gcggtgtcgcccgctgccttcgagcaggctttcggcgtgctgcgtccgcacggcacgatg
gccctcgtcggcctgccgccgggccgtttcgcgatgccgatcttcgacacggtgctgaag
cgcatcacggtacgcggctccatcgtcggcacgcgccaggacctcgaggaggcgcttgcc
ttcgccggcgacggcgccgtcgcggcccatttttcctgggaccggctcgacaacatcaac
gacgtcttcgagcgcatggaagccggcgccatcgacggccgggtcgtcctcgacctcgcc
tga

DBGET integrated database retrieval system