KEGG   Chelatococcus daeguensis: BOQ54_09680Help
Entry
BOQ54_09680       CDS       T04583                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
cdq  Chelatococcus daeguensis
Brite
KEGG Orthology (KO) [BR:cdq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cdq02022]
    BOQ54_09680
Two-component system [BR:cdq02022]
 OmpR family
  Unclassified
   BOQ54_09680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: APF37566
LinkDB All DBs
Position
2049932..2050654
Genome map
AA seq 240 aa AA seqDB search
MEPTPHIAVVDDHRDIRDLVGKYLAQHGYRISVAENATALRRLLERGAPDLVVLDIMMPG
EDGLSVCRHLRSTTDLPIILLTAMAEETDRIIGLEIGADDYLTKPFNPRELLARIKAVLR
RVNSLPPQRRDRLQARTLRFDRWVLNVGRREIVGEDGVAVALSTAEFRLLKAFLDHVGMV
LSRDQLLDLTVGRAAESFDRSIDNQVSRLRKKIEADPKNPMLIKTHWGGGYSFAAEVEEA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgacaccgcacatcgccgtcgtcgacgaccatcgcgacatccgtgatctcgtc
ggcaagtacctcgcccagcacggctatcgcatcagcgtggccgagaacgcgactgcgctg
cgccggctgctcgaacgcggcgcgccggatcttgtcgtgctcgacatcatgatgccgggc
gaggacgggctcagcgtctgccggcatctacgcagcaccaccgacctgccgatcatcctc
ctcacggccatggcagaggagacggaccgcatcatcggcctcgagatcggcgccgacgac
tatctgacgaagccgttcaacccgcgcgagctgctcgcccgcatcaaggcggtgctgcgg
cgcgtcaacagcctgccgccgcagcggcgcgaccggttgcaggcgcgcacgctccgtttc
gaccggtgggtcctcaacgtcggccggcgagagatcgtgggcgaggatggcgtcgcggtc
gccctgagcacggccgagttccgcctgctcaaggcttttctcgatcatgtcggcatggtc
ttgagccgtgaccagctgctcgacctcaccgtgggacgcgccgcggagagcttcgaccgc
agcatcgacaaccaggtcagccgcctgcgcaagaagatcgaggccgatccgaagaaccct
atgctgatcaagacccattgggggggcggctacagtttcgctgccgaagtggaggaggca
tga

DBGET integrated database retrieval system