KEGG   Chelatococcus daeguensis: BOQ54_12000Help
Entry
BOQ54_12000       CDS       T04583                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cdq  Chelatococcus daeguensis
Pathway
cdq00020  Citrate cycle (TCA cycle)
cdq00480  Glutathione metabolism
cdq01100  Metabolic pathways
cdq01110  Biosynthesis of secondary metabolites
cdq01120  Microbial metabolism in diverse environments
cdq01130  Biosynthesis of antibiotics
cdq01200  Carbon metabolism
cdq01210  2-Oxocarboxylic acid metabolism
cdq01230  Biosynthesis of amino acids
Module
cdq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cdq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BOQ54_12000
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BOQ54_12000
Enzymes [BR:cdq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BOQ54_12000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: APF37962
LinkDB All DBs
Position
2534096..2535310
Genome map
AA seq 404 aa AA seqDB search
MGKIKVANPVVELDGDEMTRIIWQYIKDKLIHPYLDIDLKYYDLGVEHRDATNDQVTIEA
AEAIKKYGVGVKCATITPDEARVKEFGLKEMWKSPNGTIRNILGGVIFREPIICKNVPRL
VPGWTQPIIVGRHAFGDQYRATDFKVPGKGRLTIKFEGEDGSVIEKEVFKFPGAGVAMAM
YNLDESIRDFARASMNYGLARKFPVYLSTKNTILKAYDGRFKDLFQEVYENEFKAKFDAA
GIHYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGQT
VEAEAAHGTVTRHYREHQKGKETSTNSIASIFAWTRGLAHRAKLDDNAELKRFADTLEKV
CIDTVESGFMTKDLALLVGADQKWLSTTGFLDKIDENLKKAMAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggttgccaacccggtcgtcgagctcgacggcgacgagatgacccgg
atcatctggcagtacatcaaggacaagctgatccacccctatctcgacatcgacctgaaa
tactacgacctcggcgtcgagcatcgcgacgcgaccaacgaccaggtaacgatcgaggcg
gccgaggccatcaagaagtacggcgtcggcgtcaaatgcgccacgatcacgcccgacgag
gcgcgcgtgaaggaattcggcctcaaggagatgtggaagtcgcccaacggcaccatccgc
aacatcctcggcggcgtcatcttccgcgagcccatcatctgcaagaacgtgccgcgcctc
gtgccgggctggacgcagccgatcatcgtcggccgccacgccttcggcgaccagtaccgc
gccacggacttcaaggtgcccggcaagggccgcctcaccatcaagttcgagggcgaggac
ggctcggtcatcgagaaggaggtcttcaagttcccgggcgccggcgtcgccatggcgatg
tacaacctggacgaatcgatccgcgacttcgcccgcgcctcgatgaactacggtctcgcc
cgcaaattcccggtctacctctccaccaagaacacgatcctcaaggcctatgacgggcgc
ttcaaagacctgttccaggaggtgtacgagaacgagttcaaggccaagttcgacgccgcc
ggcattcactacgagcaccgcctcatcgacgacatggtcgcctcggcgctcaagtggtcg
ggcggctatgtctgggcctgcaagaactacgacggcgacgtgcagtccgacaccgtggcc
cagggcttcggctcgctcgggctcatgacctcggtgctgatgacgccggacggccagacc
gtggaagccgaggccgcccacggcacggtgacgcgccactaccgcgagcaccagaagggc
aaggagacctcgaccaactcgatcgcctccatcttcgcctggacgcgcggcctcgcccac
cgggccaagctcgacgacaacgccgagctcaagcgcttcgccgacacgctcgagaaggtc
tgcatcgacacggtcgaatcgggcttcatgacgaaggacctcgccctcctcgtcggcgcc
gaccagaagtggctgtcgaccaccggcttcctcgacaagatcgatgagaacctgaagaag
gcgatggccgcctga

DBGET integrated database retrieval system