KEGG   Chelatococcus daeguensis: BOQ54_12650Help
Entry
BOQ54_12650       CDS       T04583                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cdq  Chelatococcus daeguensis
Pathway
cdq00473  D-Alanine metabolism
cdq00550  Peptidoglycan biosynthesis
cdq01100  Metabolic pathways
cdq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cdq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BOQ54_12650
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BOQ54_12650
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BOQ54_12650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdq01011]
    BOQ54_12650
Enzymes [BR:cdq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BOQ54_12650
Peptidoglycan biosynthesis and degradation proteins [BR:cdq01011]
 Precursor biosynthesis
  Amino acid ligase
   BOQ54_12650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: APF38073
LinkDB All DBs
Position
complement(2674140..2675063)
Genome map
AA seq 307 aa AA seqDB search
MTKHVAVLMGGLSAEREVSLNSGKACADALEAEGYRVTRIDVGRDIAAVLDRLRPDVVFN
ALHGSPGEDGTIQGILEIMRLPYTHSGVLASALAMDKARAKLVMAAAGVPVAHGIVVHRR
EAAERHVLPPPYVLKPVNEGSSVGVIIVREERSHPPQELTRPDWPHTDWLLAEEYIAGRE
LTCAVMGGKALGVIDIRPAAGAFYDYDAKYAKGGSIHILPAKIKPKIYQQIEELALTAHQ
ALGCRGVSRADFRYDDRPEGSGKLVCLEVNTQPGMTETSLVPELAAHAGYSFGELMRWMV
EDASCDR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacacgttgcggtgctgatgggcggcctgtccgccgagcgcgaagtgtccctc
aactcgggcaaggcctgcgccgacgccctcgaggcggagggctaccgcgtgacgcgcatc
gacgtgggccgcgacatcgcggccgtgctcgaccgcttgaggcccgacgtggtcttcaac
gcactgcacggcagcccgggagaggacggcaccatccagggcatcctcgagatcatgcgc
ctgccctatacccattccggcgtgctcgcttcggcgcttgccatggacaaggccagggcc
aagctcgtgatggcagcggccggcgtgccggtggcgcatggcatcgtggtgcaccggcgc
gaggcagccgagcgccacgtgctgccgccgccctacgtgttgaagccggtcaacgagggc
tcgtcggtcggcgtcatcatcgtgcgcgaggagcgctcgcacccgccgcaagagttaacg
cggcccgactggccgcacaccgactggctgctcgctgaggagtacattgccgggcgcgag
ctcacctgtgccgtgatgggcggcaaagccttgggtgtcatagacatccggcccgcggcg
ggcgccttttacgactatgatgcgaaatatgcgaaaggtggctcgatccacatcctcccg
gcaaaaattaaaccaaaaatttaccaacagatcgaagagttggcgttaacggcgcatcaa
gcactcggctgtcgtggcgtctcccgcgccgacttccggtacgacgaccggccagaggga
tctggcaagctcgtctgtctcgaggtcaacacgcagcccggcatgaccgagaccagcctg
gtgcccgaactggccgcgcatgcggggtattcattcggcgagctcatgcgatggatggtg
gaggacgcctcctgcgaccggtag

DBGET integrated database retrieval system