KEGG   Corynebacterium diphtheriae HC03: CDHC03_0457Help
Entry
CDHC03_0457       CDS       T01695                                 

Definition
(GenBank) putative glycosilase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
cdr00500  Starch and sucrose metabolism
cdr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CDHC03_0457
Enzymes [BR:cdr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CDHC03_0457
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CDHC03_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AEX78188
LinkDB All DBs
Position
complement(459938..461680)
Genome map
AA seq 580 aa AA seqDB search
MDVNRALARNEPICRYFYPHTTTPTTPLVITSYLTTKNTSRELSTIESMTSKSLPTRTTL
SSGTFYQIYPPSFADSNKDGIGDFRGIISRLDYLSDLGITGIWLNACFDSPFKDGGYDVR
DYTKVASRYGTHEDLVELFHQAHARGIAIILDLVPGHTSEQHPWFQQSAASEYTDFDDRY
IWTSHAFEGGAGLAFIGGEHPRNGAYIINFFKSQPALNYGFAELTQPWHQPVDAPGPRAN
QDAMVEIMKYWLSQGADGFRVDMADSLVKNDGTSKRATIGIWQSMLSQVRAEFPNAIFVS
EWGTPTQAFEAGFDADFYLDWRGNGYNLLARNTDTPLERRDDASFFNSDSATGAQEFLDM
YLPQWERTHEAGLFSFISGNHDCPRLAPRLNEQERALFFLFQLTMPGLPFIYYGDEIGLP
YAEIPTKEGGYARTGSRTPMCWDSQLPNGGFSLGDAPLYLPMTDTSQNVAQQRARADSLF
HHVQKLIQLRSQLPALDGFADLEFDLSLLKKHPKVMVYRRTHHGGDSVLIALNAGNKPIR
VEFQQPQAHEFFRCGDVTYPDLSDHSVVELGPTSGVILSV
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggatgttaacagagccttagctagaaatgaaccaatttgcagatatttttatccccac
accactacccccactaccccactggtaataacctcatacctcacaacgaaaaacacctcg
cgtgagctcagtacgatagagagcatgacgtcgaaaagccttccaactcgcaccacgtta
agctcgggaacgttctatcagatttaccctcctagctttgccgattctaataaagacggc
atcggagatttccgtggaatcatctcgcgcctcgactatctcagcgaccttggcatcacc
ggaatctggctcaacgcgtgctttgattcaccttttaaagacggcggctacgatgtgcgc
gactacacaaaggtggcttctcggtacggcacccatgaggatttggtggagcttttccac
caagcgcatgcccgcggaattgccattatcttggatctggttcctggtcacaccagcgaa
caacacccttggtttcaacaaagtgctgctagtgaatacacagattttgatgaccgctat
atttggacttcgcacgcatttgagggtggtgcggggctagcttttattggcggcgaacac
ccccgcaacggtgcgtacattattaatttcttcaaatctcaacctgcactcaattatggt
ttcgcagaattaacccagccatggcaccagccagtagatgcccctggcccgcgggcaaat
caagacgcgatggttgagattatgaagtactggttatcgcagggtgccgatggtttccgc
gtggatatggcggattcgcttgtgaaaaacgacggcacctcaaagcgggccacgattggt
atttggcagtctatgttgagccaagttcgtgccgagtttcctaatgccatctttgtctcg
gagtggggcacgcctactcaagcgtttgaggcgggctttgacgctgacttttacctcgat
tggcgcggcaatggttacaaccttttggcacgtaacacggataccccactggagcggcgc
gatgatgcaagtttctttaactctgattccgctacgggtgcccaagagtttctcgatatg
tatttgccgcaatgggagcgcacccatgaggcagggctgtttagttttatcagcggtaac
catgactgcccacgccttgcaccacgcctgaatgaacaagaacgcgcgttgttcttcttg
ttccagctcactatgcctggccttcctttcatttattacggggatgaaattgggcttccc
tatgcggagatccctacgaaggagggcggctatgcgcgcacggggtcgcgcacccccatg
tgttgggattcccagttgcctaacggcggtttttcgcttggcgacgctcccctgtacctc
cccatgactgatacatcccagaatgtggcgcagcagcgcgcgcgtgcggattcgttgttc
catcacgtacaaaagctcattcagttgcgttctcagctgccagctttagatggctttgct
gatctagagtttgatctttctctgctaaagaagcaccccaaggttatggtgtatcgccgc
actcatcatggtggcgacagcgtgcttattgccctcaatgcaggtaataagccgatacgc
gtcgagtttcagcagccccaagcacatgagtttttccgttgtggtgatgtgacatatccc
gatctctcagatcacagcgtggttgagttgggtcctacttctggtgtcatcttgtccgtg
taa

DBGET integrated database retrieval system