KEGG   Corynebacterium diphtheriae HC03: CDHC03_0467Help
Entry
CDHC03_0467       CDS       T01695                                 

Gene name
nanH
Definition
(GenBank) sialidase-1
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
cdr00511  Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cdr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CDHC03_0467 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CDHC03_0467 (nanH)
Enzymes [BR:cdr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CDHC03_0467 (nanH)
Bacterial toxins [BR:cdr02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CDHC03_0467 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 HOOK CENP-F_leu_zip Macoilin GAS DUF4200 V_ATPase_I ALMT FlaC_arch Fez1 PspA_IM30
Motif
Other DBs
NCBI-ProteinID: AEX78198
LinkDB All DBs
Position
472502..474676
Genome map
AA seq 724 aa AA seqDB search
MHSSNRTYSRAILGLSAALTLSFTSLVAPVNAEEPETVVPAIAEQEGEAPATLPSAETGL
FDAAPPKPVARGAAGDLQLPAVNEEKVFEEGRVIRAPEPDQSRCYRIPALVTAKNGDLLL
AFDNRYGGGEGAKTWCRDAPYHNKERKNTQQMQTDIQLYKSVNNGKSFEEFDFIAKGTED
SRNLSYTDPAIVVDRTNGKIFAFFVRAYDHRVGQASAGTNGLDVDAQISRRDVQDTVVVE
SRDNGRTWQNMRLISDLTKQVKSISRPGETFNGHGRFVTSGAGIQLQYGPNSGRLIVPIA
VDIDPSDSAKFVNLTIYSDDHGSNWKIGEGTAGDSTYSGDESKLVELSDGKLMMSSKDND
KTRWVAYSEDQGEHWSVPVRKIIAPPQYPNQHNTGINVGLIRAYPNAPENSAAAKVLLYS
APIDSRRGSDFDKDGRKNGWVMGSCDDGKTWSFGRQVEKNRFQYSSMTVMADGNIGMVYE
SGTREEGMNLKFAKFNMAWLGADCLSNEALGLTGDIDKEIVAAQEKAAAATKEAQEAAEK
VEKLTEELAAARKENDELKTQVKESEVAVGDLADKVFKLENAVTEAKEKATVAEKAASDA
LAKLQEAESTAEEQKAKAESAAAEAQALREKLEKLEGSILTAKENSEAEESADLSSTARD
AADTARRAATDANGALSGQKQNEEKPAMGLMGILKVLAGIIPLVAIIATIFQTFRLPFNI
PGMR
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
gtgcattcctcaaaccgaacctacagccgtgcaattctcggcctcagtgcagcattaaca
ctttcattcacatcgcttgtcgcgccagtgaatgcagaagagcccgaaactgttgtgcct
gctatcgcagaacaagaaggagaagcacctgcgacattgccgagcgctgaaactggactc
ttcgatgctgcgccaccaaagcctgttgcccgcggggcggctggagatctgcaattgccg
gcggtgaatgaagaaaaagtctttgaagaggggcgagttatccgagctccggagcctgac
cagagtcgatgctatcgaattccggcgttggtaacagcgaagaatggtgatcttcttctt
gcttttgataatcggtatggcggtggagagggagctaagacttggtgtcgagatgctcct
taccacaataaagagcgtaagaatactcaacaaatgcaaactgatatccagctatataaa
tccgtgaataatggaaagtcatttgaggagtttgattttattgctaaaggtactgaagac
tctcggaatttgtcatatacggaccctgcaattgtagtagatcgaaccaatggaaaaatc
ttcgcattttttgtacgcgcttatgatcatcgggtggggcaagcgtctgcagggacgaat
ggtctcgatgttgatgcacaaatctcaaggagagatgttcaagacactgtagtcgtcgaa
tcgcgagataacggacgcacatggcaaaacatgaggctaattagtgatcttactaaacaa
gtcaagagcatttcgcgacccggtgagacatttaacgggcatggacgatttgtaacttct
ggtgcgggtatccaacttcagtatggtcccaactcgggaaggctgattgtacctattgct
gtcgatattgatccgagtgattcggcaaaatttgtcaatcttacaatttattccgatgac
catggatcaaattggaaaattggtgagggaaccgcaggcgactcaacttattctggcgat
gaaagtaagcttgtagaactatccgatggaaagcttatgatgtcgtctaaagataacgat
aaaacccgttgggtagcctattctgaagatcaaggtgaacactggtctgttcccgtgcgc
aaaattattgcgcctccgcagtatcctaatcagcacaatacaggtattaacgtcggcctt
atccgcgcatatcctaatgctcctgaaaatagcgcagctgcgaaagtgttactatattcc
gcgccaattgattcacggcgtgggagtgactttgataaagacggtcgtaagaatggctgg
gttatgggttcttgcgatgacggaaagacatggtcctttgggcgtcaagttgaaaagaac
cgttttcagtattcaagcatgacggttatggcggatggcaacatcggtatggtctacgaa
tcaggtacccgtgaagaaggaatgaacctgaaatttgccaagttcaacatggcatggcta
ggcgcagattgcctcagcaatgaggcattgggtttgacaggcgatattgacaaggaaatc
gtcgcggcgcaagaaaaggctgctgctgcgactaaagaagctcaagaagctgcggagaag
gttgaaaagttaactgaagagttggctgctgctcgtaaagaaaatgacgagctcaagact
caggtaaaggaatctgaagtagctgttggggatctagctgacaaggtatttaagctggag
aacgccgtcacggaagcaaaagagaaagctactgtggctgaaaaagcagcatccgacgct
ctcgctaaactgcaagaagctgagtcgactgcggaagagcaaaaggctaaggctgaatct
gcagccgcagaagctcaagcattgcgtgaaaagctggagaaacttgaaggaagcattctt
actgcaaaggagaattcagaagcagaagaaagcgctgatctatcaagtacagcgagggat
gctgctgatacagctcgtcgcgctgctacggatgcaaacggtgcactttctggtcaaaag
caaaatgaagaaaagccagctatgggcttgatgggaatcttgaaagtgcttgcggggatc
attccactggtagcgatcattgcgactatattccaaacattccgtttgccttttaacatt
cctggaatgaggtag

DBGET integrated database retrieval system