KEGG   Corynebacterium diphtheriae HC03: CDHC03_1036Help
Entry
CDHC03_1036       CDS       T01695                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
cdr00473  D-Alanine metabolism
cdr00550  Peptidoglycan biosynthesis
cdr01100  Metabolic pathways
cdr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cdr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CDHC03_1036 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CDHC03_1036 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CDHC03_1036 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdr01011]
    CDHC03_1036 (ddl)
Enzymes [BR:cdr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CDHC03_1036 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:cdr01011]
 Precursor biosynthesis
  Amino acid ligase
   CDHC03_1036 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp ATP-grasp_4 ATPgrasp_ST CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AEX78767
LinkDB All DBs
Position
1077746..1078843
Genome map
AA seq 365 aa AA seqDB search
MSQNLSAQNSSETPRIKVAIIYGGRSSEHSVSCVSAGAIMAHLDPQRYEVFPVGITHDGV
WTVGESDPSRLKTVDRVMPEVQFTREVSLSVNPNTAGELRFEDGSLYAKVDVVFPVLHGR
FGEDGTIQGLFELSGVPYVGTGVLSSACGMDKEFTKKLMAAEGLPVGKEVILRGSETLTE
EHKRELGLPVFVKPARGGSSIGISRVADWSEWDAALSLAREHDSKVIVEAEIVGVEVECG
VLERIDGSLVASVPAQLQDTDEGDEGFYGFDTKYLDDVVTAHIPAPFDAETTALIQELSL
KAFTALSCRGLARVDFFITDHGPVLNEINTMPGFTPISMYPQVFEATGIGYAQLLDNLIE
QALHK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaaaatctttcagcacagaactcttcagaaactcctcgtattaaagttgccatc
atctatggtggccgcagctcagaacattccgtgtcgtgtgtgtctgccggcgctattatg
gcgcaccttgatccgcagcgctacgaggtgttcccagtaggtatcacgcacgacggtgtg
tggactgtgggggaatcggatccgagtcgacttaagactgtcgaccgtgtgatgccagag
gttcagttcacaagggaagtatcgttgtcggtcaacccaaacaccgctggcgagctacgt
ttcgaggacggatcgctttatgccaaagtcgatgtagtcttcccagtcttgcatggtcgc
tttggcgaagacggtacgatccaaggtctatttgagctctctggtgtgccctacgttgga
actggtgtgttgagctccgcttgcggaatggacaaggaatttactaagaagctcatggcg
gctgaaggtttgccagttggcaaggaagttatccttcgcggctcggaaacgttgactgaa
gaacataagcgtgagcttggtttgccagtgtttgttaaacctgctcgtggtggatcatcc
attggtatttctcgggtagctgattggagcgaatgggacgcggcgttaagccttgcacgc
gagcacgattctaaggtgatcgtcgaagctgaaattgtgggtgtagaggtcgaatgcggt
gtgcttgagcgtatcgacggctccttggtggcgtctgttcccgcccagctgcaagatacc
gatgaaggcgacgaaggtttctatggtttcgataccaaatacctcgatgatgtggtgacc
gctcacattccagcacccttcgatgcggaaactactgcgttgattcaagagctgtcgctg
aaggctttcacagctttaagctgccgtggtttggcacgcgtggacttttttatcactgat
catggacctgtgctcaacgagatcaataccatgccaggttttactccgatctcgatgtac
ccccaggtattcgaagcgaccggaattggttatgcgcagctgctcgataacttgatcgag
caggccttgcacaaataa

DBGET integrated database retrieval system