KEGG   Clostridium drakei: B9W14_05015Help
Entry
B9W14_05015       CDS       T05484                                 

Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
cdrk  Clostridium drakei
Pathway
cdrk00340  Histidine metabolism
cdrk01100  Metabolic pathways
cdrk01110  Biosynthesis of secondary metabolites
cdrk01230  Biosynthesis of amino acids
Module
cdrk_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cdrk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    B9W14_05015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His tRNA-synt_2b TetR_C_19 RVT_3
Motif
Other DBs
NCBI-ProteinID: AWI03874
UniProt: A0A2U8DNS4
LinkDB All DBs
Position
1086374..1087549
Genome map
AA seq 391 aa AA seqDB search
MISWKRYIPEGTKDTLFEECTRKVEIENILRKTYTCSGFLEVKSPTLEFYDVFSGESSTL
AQEKMYKLFDNHGRILVLRPDMTTPIARIAATKLKEVTHPLRLCYTSNVYRVNESLNGKN
SEITQSGIEIIGVKNLKADAEAIITGITALINCGVEDFKVELGHAEFFKAIIENVDIDDE
EKEKLRVYIENKNFTALSELLDKNRNNMNKDTLKILKELPKLFGNMDILDVVYTFTDNEK
ALEAINDIKSVYEIIKDAGLGDYVSVDLGMVHYLNYYTGIIFRGYAEGVGGNILSGGRYD
NLIKQFGEQQEATGFAVNVDSIISALENCGQINESKVKKILIYYKNVDFKKAYDKALKLR
EEGSIAELSLFDSQKEAEEYAEEKRMEFIIV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgataagttggaaaagatatattccagaaggaacaaaagatacattatttgaagagtgt
acaaggaaagtggaaatagaaaatatacttagaaaaacttatacatgcagtggattttta
gaagttaaatctcctactttggagttttatgatgtttttagtggagaaagttctacttta
gctcaagaaaaaatgtataagctatttgataatcatggaagaatattagtacttagaccg
gatatgacaacccctatagctagaatagctgctacaaagttaaaagaagttacccatcca
ttgagattatgttatacatcgaatgtctatagagtaaatgaaagtttaaatggaaaaaat
agtgaaattactcagtcaggtattgaaattattggagttaaaaatttaaaagctgatgca
gaagctataattacaggaataacagctttaataaattgcggagtagaagattttaaagta
gagcttggtcatgctgaattttttaaagccataatagaaaacgtggatatagatgatgaa
gaaaaagaaaaacttagagtatatatagaaaataaaaactttacagctttaagtgagctt
ttagataaaaatagaaataatatgaataaagatacattaaaaatattaaaggaattacca
aaattatttggaaatatggacatactagatgtggtttatacttttacagataacgaaaaa
gcattagaagcgataaatgatataaaatcagtatatgaaataataaaggacgcaggatta
ggagattatgtatctgtagatttgggtatggtgcattacttaaattattatacgggaata
attttcagaggatatgcagaaggtgttggaggaaacatattaagtggaggaagatatgat
aacttaataaaacagtttggtgaacagcaagaggccactggttttgcagtaaatgtagat
agtattataagtgcattagaaaattgtggacaaattaatgaaagtaaagtaaaaaagatt
ttaatttattataagaatgtagattttaagaaagcttatgacaaggctttaaaacttaga
gaagagggtagtattgcagaattaagtttatttgattctcaaaaagaagctgaagagtat
gcggaagaaaagagaatggagtttattatagtttag

DBGET integrated database retrieval system