KEGG   Corynebacterium diphtheriae C7: CDC7B_2325Help
Entry
CDC7B_2325        CDS       T01699                                 

Gene name
trpE
Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
cds  Corynebacterium diphtheriae C7
Pathway
cds00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cds01100  Metabolic pathways
cds01110  Biosynthesis of secondary metabolites
cds01130  Biosynthesis of antibiotics
cds01230  Biosynthesis of amino acids
cds02024  Quorum sensing
Module
cds_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cds00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDC7B_2325 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    CDC7B_2325 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CDC7B_2325 (trpE)
Enzymes [BR:cds01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CDC7B_2325 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AEX68510
LinkDB All DBs
Position
2468847..2470175
Genome map
AA seq 442 aa AA seqDB search
MVARLQEHFDTSGTKFSFRRSELHDERQRLLDTNNAEILRLLQCEAGYSGEQLPLLAGGF
AFDYVETFEQLPPVPVGDNSYPDYQFVVAETVLVTDHLKRSAVIEGVSVDPAELGDRLDS
LVATIDSHKTVEEGPANTSPNETLTVRADISDIDFCQSVSALQDNIQAGDIYQVVPARSF
SAPCESAYAAYRYLRATNPSPYMFYVRGITPIAYNSNKTYELIGASPESNLKFDSNTREV
QLYPIAGTRPRGLNPDGSINHELDIRAELDMRTNAKEIAEHTMLVDLARNDLARVSLPTT
RRVAELLQVDRYSRVMHLVSRVVATLGPEFDTIDAYRACMNMGTLTGAPKLRAMELLRGV
EAKRRGSYGGAVGYLQGDGSMDTCIVIRSAFIQDGVAVVQAGAGVVRDSIPQSEADETLH
KAYAVLHAIALAAGKDLGVIRS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgcgcttacaggagcactttgacacgagcggcacgaaatttagtttccgccgc
tccgagcttcacgacgaacgccagcgcctccttgacaccaataacgccgagattcttcgc
ctcctacagtgtgaggccggctattccggtgagcagttaccacttcttgccggcggtttt
gccttcgactacgtggagacatttgagcaattacctcctgtgccggtaggggataattct
tatcccgattaccagtttgtggtggcagaaacagtgctggtcaccgatcatctcaagcgc
agcgcggtgatcgagggcgtgtccgttgaccctgcagagttgggggatcgactagattcc
cttgttgccacgattgacagccataaaacagtcgaggaaggtcccgcaaacacatcaccc
aatgagacattgactgtgcgtgccgatatttctgatatagatttttgccagagcgtaagc
gcgctgcaggacaatatccaggcgggagacatctatcaggtggttccagcacgcagcttt
agcgcgccctgcgaaagtgcttatgcagcttatagatacttgcgcgcaaccaatcccagc
ccctatatgttttacgttcgcggcattactcccattgcatacaattcaaataaaacatat
gagctgataggagcctcgccggaatctaatctcaagttcgattcgaacacgcgtgaggtt
cagctatatccgatcgccggcactcgtccacgcggacttaatcccgacggaagcattaat
cacgaactcgatattcgcgccgaattggacatgcgaaccaatgccaaggaaatcgccgaa
cacaccatgttggttgatcttgcacgcaatgatcttgcacgtgtttcattgcccacaaca
cgtcgcgttgcagagttattgcaggtagatcgctactctcgagtgatgcacctcgttagc
cgcgtggtggctacgctgggtccagagttcgatactattgacgcctaccgtgcctgtatg
aacatgggaacgctaactggtgcaccaaaattgcgtgcaatggaattgctgcgaggggtg
gaagctaaacgtcgcggttcctatggtggtgcggttggataccttcaaggagatggttcg
atggacacctgcattgtgattcgttccgcctttattcaggatggggtagcggtggtgcag
gccggtgccggagtggtgcgggattctattccacaatcggaggccgatgagacactccat
aaggcctatgccgttttgcatgccattgcgttggcggccggaaaggatctgggggtgatt
cgctcatga

DBGET integrated database retrieval system