KEGG   Corynebacterium diphtheriae HC01: CDHC01_0311Help
Entry
CDHC01_0311       CDS       T01693                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00020  Citrate cycle (TCA cycle)
cdt00190  Oxidative phosphorylation
cdt00650  Butanoate metabolism
cdt01100  Metabolic pathways
cdt01110  Biosynthesis of secondary metabolites
cdt01120  Microbial metabolism in diverse environments
cdt01130  Biosynthesis of antibiotics
cdt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDHC01_0311 (sdhA)
   00650 Butanoate metabolism
    CDHC01_0311 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CDHC01_0311 (sdhA)
Enzymes [BR:cdt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CDHC01_0311 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CDHC01_0311 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 NAD_binding_8 Pyr_redox GIDA
Motif
Other DBs
NCBI-ProteinID: AEX73564
LinkDB All DBs
Position
296847..298862
Genome map
AA seq 671 aa AA seqDB search
MSINSDTTVSTDFTQPASIVDGVKLGSILESHEPKGVPTKDMWEYQKNHMNLVSPLNRRK
FRVLVVGTGLSGGGAAAALGELGYDVKVFTYHDAPRRAHSVAAQGGVNAARGKKVDNDGA
YRHVKDTVKGGDYRCRESDCWRLAYESVRVIDHMNAIGAPFAREYGGTLATRSFGGVQVS
RTYYTRGQTGQQLQLAGAAALQRQIGLGTVEIFTHNDLADLVLTEKDGKKRCEGVVMRNL
ITGELTAHTGHAVILATGGYGNVFHMSTLAKNSNASAMMRAYDHGAYLASPSFIQFHPTG
LPVNSEWQSKTILMSESLRNDGRIWSPLEPKDDRDPNTIPEEERDYFLERRYPAFGNLVP
RDVASRAISQQINKGLGVGPLHNSAYLDFRDAISRLGEDTIRERYSNLFQMYEEAIGENP
YKAPMRIAPTCHFTMGGLWTDFNEMTSIDGLFAAGECSWTYHGANRLGANSLLSASVDGW
FTLPFTIPNYLANHLGEPRLAEDSAEAQEAVNRAKARIDKLMNIKGNDPHGPEFFHRQLG
EILYFSCGVARNVEDLKTGIQKIRALRKEFWANLRITGAADEMNQVLEYASRVADYIDLG
ELMCVDALDRDESCGAHFRDDHLSEEGEAERDDDNWCFVSAWEPGAVEGEFIRHAEPLTF
EAIPLMTRNYK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaactctgacaccactgttagcaccgacttcacccaaccagcatccatcgtt
gatggtgtgaagctcggcagcatcctcgagtctcatgagcctaagggcgttcccaccaag
gacatgtgggagtaccaaaagaaccacatgaacctcgtgtcgcctttgaaccgtcgtaag
ttccgcgtcctcgtggtcggcaccggcctgtccggtggcggcgctgcggctgctctcggc
gagctcggctacgacgtcaaggtgttcacctaccacgacgcaccacgtcgtgcacactcc
gtcgctgcacagggtggcgtcaacgctgctcgcggcaagaaggtggacaacgacggtgca
taccgccacgtcaaagacaccgttaagggcggcgactaccgctgccgtgagtccgactgc
tggcgcttggcatacgagtccgtccgcgtgatcgaccacatgaacgccatcggtgcacca
ttcgctcgcgaatacggcggaaccctggcaacccgttccttcggtggcgtgcaggtttcc
cgcacctactacacccgtggtcaaacaggtcagcagctgcagctggctggtgctgctgct
ctacagcgccagatcggcttgggcaccgtggagatcttcacccacaatgacctagcagac
ttggttctcaccgagaaggacggcaagaagcgctgtgaaggtgtggttatgcgtaacctc
atcaccggcgagctcaccgctcacaccggccacgcagtgatcttggcaaccggtggctac
ggcaacgtattccacatgtccaccttggctaagaactccaacgcatccgcaatgatgcgt
gcatacgatcacggtgcatatctcgcatcgccatcgttcatccagttccacccaaccggt
cttcctgtgaactccgagtggcagtccaagaccatcttgatgtccgagtctttgcgtaac
gacggccgcatctggtcgccactggagccaaaggatgaccgcgacccgaacaccatccct
gaggaagagcgcgactacttcctggagcgtcgttacccagcattcggtaacttggttcct
cgcgacgtagcatctcgtgcaatctctcagcagatcaacaagggcctcggcgttggacct
ctgcacaactccgcttacttggacttccgcgatgccatcagccgcctcggcgaagatacc
atccgtgagcgttactccaacctcttccagatgtacgaagaggccattggtgagaaccca
tacaaggcgccaatgcgtattgctcctacctgccacttcaccatgggtggcctgtggacc
gacttcaatgagatgacctccattgatggcctgtttgcagcaggtgagtgctcgtggacc
taccacggtgctaaccgcctaggtgcaaactccctcctgtctgcttccgttgacggctgg
ttcaccctgccgttcaccatccctaactacttggcaaaccaccttggtgagccacgtttg
gctgaggattctgcagaagcacaggaagctgttaaccgcgccaaggcacgcattgacaag
ctgatgaacatcaagggcaatgatcctcacggccctgagttcttccaccgccagctgggc
gagatcctctacttctcttgtggcgttgcccgcaacgttgaggatctcaagaccggtatt
cagaagatccgcgctctgcgcaaggaattctgggcaaacctgcgtatcaccggcgctgcc
gatgagatgaaccaggttctcgagtacgcatcccgcgttgctgactacatcgacttgggc
gagctcatgtgcgtcgacgcacttgaccgtgatgagtcctgtggtgcccacttccgtgac
gatcacctctccgaagagggcgaggcagagcgtgacgacgacaactggtgcttcgtttcc
gcatgggagccaggtgcagtcgagggcgagttcattcgccacgctgaaccactcacattc
gaagcgatcccgctgatgacaaggaattacaagtaa

DBGET integrated database retrieval system