KEGG   Corynebacterium diphtheriae HC01: CDHC01_0312Help
Entry
CDHC01_0312       CDS       T01693                                 

Gene name
sdhC
Definition
(GenBank) succinate dehydrogenase reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00020  Citrate cycle (TCA cycle)
cdt00190  Oxidative phosphorylation
cdt00650  Butanoate metabolism
cdt01100  Metabolic pathways
cdt01110  Biosynthesis of secondary metabolites
cdt01120  Microbial metabolism in diverse environments
cdt01130  Biosynthesis of antibiotics
cdt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDHC01_0312 (sdhC)
   00650 Butanoate metabolism
    CDHC01_0312 (sdhC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CDHC01_0312 (sdhC)
Enzymes [BR:cdt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CDHC01_0312 (sdhC)
    1.3.5.4  fumarate reductase (quinol)
     CDHC01_0312 (sdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_10 Fer4_8 Fer4_17 Fer4_9 Fer4 Fer4_18 Fer4_16 Fer4_15 Fer4_4 Fer4_2 Fer4_6 Fer4_21 Fer4_3 Fer2 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: AEX73565
LinkDB All DBs
Position
298862..299611
Genome map
AA seq 249 aa AA seqDB search
MKLHLEIWRQAGPNSEGHFEPIDVNDAVPQMSVLELLDHVNTGLIEEGKEPFVFASDCRE
GICGTCGLLVNGRPHGLDKNKPSCQQRLDHVPDGSTLKIEPLRSAAYPVVKDLLVDRSAL
DRVLEKGGFVSINAGTAPDADTLHQNHESAELALDHAACIGCGACVAACPNGAAHLFTGA
KLIHLSLMPLGKEERGKRARKMVDELETNFGHCSLYGECADVCPAGIPLSAVAAINKERA
RAFFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccatcttgaaatctggcgtcaggccggtccaaacagcgaaggtcacttcgag
cccatcgacgtcaacgacgccgttcctcaaatgtcggtcctcgagcttctcgaccacgtc
aacactggcctgattgaggaaggcaaagagcctttcgtattcgcctccgactgccgcgag
ggcatctgtggtacctgtggccttttggtcaacggtcgcccacatggcttggacaagaac
aagccttcttgccagcagcgcctcgaccacgtcccagacggatcgaccctgaagatcgag
ccactgcgctccgcagcttacccagtggtcaaggacctcttggtagatcgctccgcactg
gaccgcgtcttggaaaagggcggcttcgtttccatcaacgccggcaccgctcctgatgca
gacaccctgcaccagaaccacgagtctgccgagttggctctcgaccacgcagcctgcatc
ggctgtggtgcttgtgtggctgcttgccctaacggcgcagctcacttgttcaccggtgca
aagctgatccacctctccctgatgcctttgggcaaggaagagcgcggcaagcgtgcacgc
aagatggtcgacgagttggagacaaacttcggacactgctccctctacggtgagtgcgcg
gatgtttgccctgcaggtatcccactgtccgcagttgcggcaatcaacaaggaacgggct
cgtgcgttcttccgtggcaaggacgactaa

DBGET integrated database retrieval system