KEGG   Corynebacterium diphtheriae HC01: CDHC01_0471Help
Entry
CDHC01_0471       CDS       T01693                                 

Definition
(GenBank) putative glycosilase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cdt  Corynebacterium diphtheriae HC01
Pathway
cdt00500  Starch and sucrose metabolism
cdt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CDHC01_0471
Enzymes [BR:cdt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CDHC01_0471
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CDHC01_0471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Malt_amylase_C Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AEX73724
LinkDB All DBs
Position
complement(458481..460223)
Genome map
AA seq 580 aa AA seqDB search
MDINRALARNEPICRYFYPHTATPTTPLVITSYLTTKNTSRELSTIESMTSKSLPTRTTL
SSGTFYQIYPPSFADSNKDGIGDFRGIISRLDYLSDLGITGIWLNACFDSPFKDGGYDVR
DYTKVASRYGTHEDLVELFHQAHARGIAIILDLVPGHTSEQHPWFQQSAASKYTDFDDRY
IWTSHAFEGGAGLAFIGGEHPRNGAYIINFFKSQPALNYGFAELTQPWHQPVDAPGPRAN
QDAMVEIMKYWLSQGADGFRVDMADSLVKNDGTSKRATIGIWQSMLSQVRAEFPNAIFVS
EWGTPTQAFEAGFDADFYLDWRGNGYNLLARNTDTPLERRDDASFFNSDSATGAQEFLDM
YLPQWERTHEAGLFSFISGNHDCPRLAPRLNEQERALFFLFQLTMPGLPFIYYGDEIGLP
YAEIPTKEGGYARTGSRTPMCWDSQLPNGGFSLGDAPLYLPMTDTSQNVAQQRERADSLF
HHVQKLIQLRSQLPALDGFADLEFDLSLLKKHPKVMVYRRTHHHGDSVLIALNAGNKPIR
VELQQPQAHELFRCGDVTYPDLSDHSVVELGPTSGVILSV
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggatattaacagagccttagctagaaatgaaccaatttgcagatatttttatccccac
accgctacccccactaccccactggtaataacctcatatctcacaacgaaaaacacctcg
cgtgagctcagtacgatagagagcatgacgtcgaaaagccttccaactcgcaccacgtta
agctcgggaacgttctatcagatttaccctcctagctttgccgattctaataaagacggc
atcggagatttccgtggaatcatctcgcgactcgactatctcagcgaccttggcatcacc
ggaatctggctcaacgcgtgctttgattcaccttttaaagacggcggctacgatgtgcgc
gactacacaaaggtggcttctcggtacggcacccatgaggatttggtggagcttttccac
caagcgcatgcccgcggaattgccattatcttggatctggttcctggtcacaccagcgaa
caacacccttggtttcaacaaagtgctgctagtaaatacacagattttgatgaccgctat
atttggacttcgcacgcatttgagggtggtgcggggctagcttttattggcggcgaacac
ccccgcaacggtgcgtacattattaatttcttcaaatctcaacctgcactcaattatggt
ttcgcagaattaacccagccatggcaccaaccagtagatgcccctggcccgcgggcaaat
caagacgcgatggttgagattatgaagtactggttatcgcaaggtgccgatggtttccgc
gtggatatggcggattcgcttgtgaaaaacgacggcacctcaaagcgggccacgattggt
atttggcagtctatgttgagccaagttcgcgccgagtttcctaatgccatctttgtctcg
gagtggggcacgcctactcaagcgtttgaggcgggctttgacgctgacttttacctcgat
tggcgcggcaatggttacaaccttttggcacgtaacacggataccccactggagcggcgc
gatgatgcaagtttctttaactctgattccgctacgggtgcccaagagtttctcgatatg
tatttgccgcaatgggagcgcacccatgaggcagggctgtttagttttatcagcggtaac
catgactgcccgcgtcttgcaccacgcctgaatgaacaagaacgcgcgttgttcttcttg
ttccagctcactatgcctggccttcctttcatttattacggggatgaaattgggcttccc
tatgcggagatccctacgaaggagggcggctatgcgcgcacggggtcgcgcacccccatg
tgctgggattcccagttgcctaacggcggtttttcgcttggcgacgctcccctgtacctc
cccatgactgatacatcccagaatgtggcgcagcagcgtgagcgtgcggattcgttgttc
catcacgtacaaaagctcattcagttgcgttctcagctgccagctttagatggctttgct
gatctagagtttgatctttctctcctaaagaagcaccccaaggttatggtgtatcgccgc
actcatcatcatggcgacagcgtgcttattgccctcaatgcaggtaacaagccgatacgc
gtcgagcttcagcagccccaagcacatgagcttttccgttgtggtgatgtgacatatccc
gatctctcagatcacagcgtggttgagttgggtcctacttctggcgtcatcttgtccgtg
taa

DBGET integrated database retrieval system