KEGG   Corynebacterium diphtheriae HC01: CDHC01_1552Help
Entry
CDHC01_1552       CDS       T01693                                 

Gene name
pknL
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdt  Corynebacterium diphtheriae HC01
Brite
KEGG Orthology (KO) [BR:cdt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdt01001]
    CDHC01_1552 (pknL)
Enzymes [BR:cdt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CDHC01_1552 (pknL)
Protein kinases [BR:cdt01001]
 Serine/threonine kinases: Other
  Bacterial family
   CDHC01_1552 (pknL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-ProteinID: AEX74796
LinkDB All DBs
Position
1632520..1634712
Genome map
AA seq 730 aa AA seqDB search
MADLKIGDVLENRYRIEAPIARGGMSTVYRCVDTRLGRLVAAKVMDQRYLDDPIFKDRFR
REARSMAQLSHPCLVGVYDFSSDGDNIFLIMELITGGTLRELLAERGPMPPHAAVAVMRS
VLTGLSVAHSAGMVHRDIKPDNVLINADHQVKLADFGLVRAASASQATSNQIVGTVSYLS
PEQVSGDDIGPESDVYSAGIVMFELLTGTTPFSGDNQIAHAYARLDSAVPAPSSMIAGIP
PLIDALVASATALRPEERFADAAEFLNALDDVAQELRLPEFRVPVPANAAAYRSNEHLTG
HFTTSDLMTTDLPRETEGLFPIEDASTHTRAFQPITPQPAAPIGPVAQRKPDYSPEPVAP
QHDPAATHEPVTNRSKISFVLWLIAVITLATAVALGAWWFGSGRYGEVPQVLGLDQVQAV
AVTEESGFGAVTEPVYSDDIPKNAIAGTKPDQGQRAVKGDDITLLVSQGRPTVPDVPQSR
SASEYRRLLEERTLEYRESAPEFSDSVPEGKIARVVPGSGNEVAVGSAVSVALSQGPAPV
TIPNVSERPVDQARNELEKLGFDVTIAKEFSDTIPGGDAIGTDPAAGTTLPRGSSVTLKV
STSVEIPDVRGKSRHDAISALADAGITVESISRSDNEVGNSADEVTSITPSSGSLIDPAH
TKVSLVLAGRVEVPSVVGKRYAEAKRELEAAGFSVTTSGTSKSSARVYWQTPAGGRAEPG
ATIKLKTLSS
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggcagatctgaaaatcggcgacgtgctagaaaaccgttatcgcatcgaggctcctatt
gctaggggtgggatgtcaacggtctaccggtgtgtggatacccgcttgggtcggcttgtc
gctgcgaaagtaatggatcagcgttatctagacgacccgattttcaaagaccgcttccgt
agggaagctcgctccatggcccagttgagtcacccatgtttggtgggagtctatgacttt
tcttccgatggcgacaacatcttcctcattatggagctgatcaccggcggcactttgcgc
gagcttttggccgaacgcgggcctatgcctcctcatgcagcggtcgccgtcatgcgttcg
gttctgactggtttgtccgtagcccactcagcgggcatggttcatcgcgatatcaaaccc
gacaatgtgttaataaacgccgatcatcaggtgaagttggcggactttggtttggtgcgg
gcggcgtcggctagccaagcgacttccaatcaaatcgtcggcacggtgtcttatctttcc
cctgagcaagtttctggcgatgacatcggacccgaaagcgatgtgtactccgccggcatc
gtgatgttcgagttactcaccggcaccactccgtttagcggcgacaatcaaattgcgcat
gcttacgcgcgtctcgatagcgcagtgccagcaccttcatccatgatcgcaggaattcca
ccgcttatcgacgccctcgttgcttctgctacagcgctacgccccgaagaacgcttcgcc
gatgcagcagagtttctcaatgcgctagacgacgtagctcaagaactacgtctcccagaa
ttcagagtgccagtacctgccaatgctgcagcttatcgttccaatgaacatctcactggc
catttcacaacgtccgacctcatgaccacggacctgccgagagaaactgaaggcctgttc
cctatcgaagacgccagcactcatactcgcgccttccaaccaattacgccacagcctgct
gcccccatcgggcctgttgcacaacgaaaaccagactattctcctgaaccagtagcacca
caacatgacccagctgcaacgcatgagcccgtcaccaatcgctccaaaatcagttttgtt
ttgtggctcatagctgtcattaccctagccaccgcggtagcccttggcgcatggtggttt
ggttctggacgctatggtgaagtcccccaggtcttgggcctcgaccaagtacaagccgta
gccgttaccgaggaatccggctttggcgcagtcaccgagcctgtatatagcgacgacatt
cctaaaaatgccatcgctggcacgaaaccagaccagggtcaacgtgctgtgaaaggtgac
gacatcacgttgctggtatcccaaggacgcccgaccgttcctgatgttcctcaaagtcgt
tcagcttccgagtaccgtcgcttgctcgaagagcgcacacttgagtaccgcgaaagcgcc
cccgaattttctgattccgtgcccgaaggaaaaatcgcccgtgttgtaccaggttcgggc
aacgaagtcgcagtcggcagtgccgtatcagttgcactttcccaaggtccagcgcctgtg
accatccccaatgtttctgaacgtcccgttgatcaagcgcgaaacgagctggaaaaacta
ggattcgacgtcaccatcgccaaagaatttagtgacaccatccctggcggtgacgcaatc
ggtaccgaccccgcagcaggcactactctcccccgcggcagctcagtaactcttaaagtt
tctacctctgtagaaattcctgatgttcgtggaaaatcgcgtcatgatgccatcagcgct
cttgctgatgcaggtattaccgtggagtcgatttctcgttccgataatgaggtaggcaat
tctgcagacgaggtcacatcgattacaccaagttctggtagtctcatcgatcctgcacat
accaaagtctcgttggttcttgcgggcagagtcgaagtgccttctgttgtaggtaaacgc
tacgctgaggctaaacgcgaactagaggcagcaggctttagcgtgaccacaagcgggacg
agtaagtcttctgcacgagtgtattggcagactcctgccggtggacgtgctgaaccaggg
gctaccatcaaactcaaaaccctgagctcttag

DBGET integrated database retrieval system