KEGG   Candida dubliniensis: CD36_04500Help
Entry
CD36_04500        CDS       T01140                                 

Definition
(RefSeq) alcohol dehydrogenase, putative
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cdu  Candida dubliniensis
Pathway
cdu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CD36_04500
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CD36_04500
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CD36_04500
    1.1.1.-  
     CD36_04500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc
Motif
Other DBs
NCBI-GeneID: 8044656
NCBI-ProteinID: XP_002417119
UniProt: B9W7P8
LinkDB All DBs
Position
1:1020176..1021345
Genome map
AA seq 389 aa AA seqDB search
MKAIVYHDRGDIRYDPDFPDPKIIRSDDVKIKVHYCGICGTDLKEYTDGPIFFPPKGKLN
EISQMESIQVMGHEISGEIIAIGDDVTNVKVGDKVVVEVTGTCLDRHRYLDSQHEDVSKP
NCPSCTSGNYNACDHLSLIGCGFANGGCAEYLVVASSKVIAFDNDKIPMDIAALIQPIAV
SWHAVKVSNFKPGSNALILGGGPIGLTTIFALKGNQVSQIVLSEPALARRELAEKLGVIT
FDPTGKSIEQCVAELKKLSPGGYGYEYSYDCSGVKVTFETGLKTLKIRGCATNVAIWAHK
SIPLYPMEITLSEKMLTGSICFVKKDFQESIQAIENGLISIDELQMLITSKIHLQDGIEK
GFLELINHKEKHIKILFSPKSVYLPSNGK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccattgtatatcatgatagaggagatattcgatacgatcctgatttccctgat
ccaaaaatcattcgactggatgatgtcaaaatcaaagttcattattgtgggatctgtggt
actgatttaaaagaatacactgatggaccaatttttttcccaccaaaaggtaaattgaat
gaaatttcacaaatggaatcaattcaagtaatgggtcatgaaattagtggtgaaataatt
gctattggtgatgatgtaactaatgttaaagtaggtgataaagtagttgttgaagttaca
ggtacttgtttagacagacatcgttacctcgattctcaacatgaagatgtttccaaaccc
aattgtccgagttgtacttctgggaattataatgcttgtgatcatctttcattaattggt
tgcggattcgctaatggtggatgtgctgagtatttagttgttgccagtctgaaagttatt
gcatttgataatgacaaaatccctatggatatagcggcattaattcaaccaatagctgtt
agttggcatgctgttaaagtgtcaaattttaaacctggctccaatgcattgattttaggt
ggtggccccattggattaacgacaatttttgcattgaaaggtaatcaagtttcacaaatt
gttctaagtgaaccagcattagcaagacgtgaattggctgaaaaattaggggttattact
tttgatcctacaggtaaatcaattgaacaatgtgtagcagaattgaaaaaattatcaccg
ggtggatatggatatgaatattcttatgattgttctggggttaaagtaacgtttgaaact
ggcttgaaaactttgaagattcgtggatgtgctacaaatgttgccatttgggctcataaa
tcaattccattataccctatggaaattactctttcagaaaaaatgttaacaggatcaatt
tgtttcgttaaaaaagattttcaagaatcaattcaagcaattgaaaatggtttaatatct
attgatgaattgcaaatgttgattactctgaaaattcatttacaagatggaattgaaaaa
ggttttttagaattaattaatcataaggaaaaacatattaaaatattgttttcaccgaaa
agtgtatatttaccatctaatggtaaataa

DBGET integrated database retrieval system