KEGG   Candida dubliniensis: CD36_05000Help
Entry
CD36_05000        CDS       T01140                                 

Definition
(RefSeq) flavoprotein subunit of mitochondrial complex II, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cdu  Candida dubliniensis
Pathway
cdu00020  Citrate cycle (TCA cycle)
cdu00190  Oxidative phosphorylation
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
cdu01200  Carbon metabolism
Module
cdu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cdu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CD36_05000
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CD36_05000
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CD36_05000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 8044703
NCBI-ProteinID: XP_002417166
UniProt: B9W7U5
LinkDB All DBs
Position
1:complement(1143528..1145444)
Genome map
AA seq 638 aa AA seqDB search
MFTKRIRQAVQVPNRFFSNSSSVLQTIGRIKGVEANSKKYLQQKYVVIDHEYDCVVVGAG
GAGLRAAFGLAESGFKTACISKLFPTRSHTVAAQGGINAALGNMHKDDWHWHFYDTVKGS
DWLGDQDAIHYMTKEAPDSIYELEHFGVPFSRNDEGRIYQRAFGGQTKEFGKGGQAYRTC
AVADRTGHALLHSLYGQALRHDCHFFIEFFAMDLLMQDGECVGVIAYNQEDGTIHRFRSH
KTVIATGGYGRAYFSCTSAHTCTGDGYAMASRAGLPLQDLEFIQFHPSGIYGSGCLITEG
ARGEGGFLVNSEGERFMERYAPSAKDLACRDVVSRAITMEINEGRGVGTEKDHMYLQLSH
LPASVLKQRLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTNWQGEVLKKDHEGKD
KVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVSHTIRDNLTPGTSLHASPADLG
KTSIENLHRLRTADGTRSTAEIRLDMQKTMQRGCAVFRTEETLEKCVNHINDVDKSFADV
RTTDRSMIWNSDLVETMELQNLLTCATQTAASALARKESRGSHSREDYPDRDDVNWWKHT
LSYQNNVGSEVKLDYRDVIKTTLDTTDCQPIPPAVRKY
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtttacgaaacgcattagacaagctgtacaagtaccgaatcgtttctttagcaacagc
tctagtgttcttcaaaccattggcagaattaaaggggtcgaagctaactcaaagaaatat
ttgcaacaaaaatacgtggttattgatcatgaatatgattgtgtggtagttggggctggt
ggtgccggattgagagctgcatttgggttggcggagtcaggattcaagacagcatgtata
tcaaagttgttccccaccaggtcacatacagtcgctgcacagggaggtattaacgcagca
ctaggtaatatgcataaagatgattggcattggcatttctacgataccgtgaaaggatct
gattggctaggagaccaggatgccatccactatatgacaaaagaagcaccagattctatc
tatgaattggagcactttggtgttccattttctagaaatgatgaaggcagaatctaccaa
agagcatttgggggccaaacaaaagagtttggaaaagggggacaggcctatagaacatgt
gccgtagctgatagaactggccacgctttgttacattcattgtatggtcaagctttgaga
catgattgtcatttttttatagagttctttgccatggatttgcttatgcaggacggtgaa
tgtgttggtgtaatagcctacaaccaggaggatggtacgatacatagattccgatctcat
aaaactgtgattgctacgggtggttacggtagagcatatttttcatgtacttcagcacat
acatgtaccggtgacggatacgccatggcgtctagagctggattacctttacaagattta
gaattcattcaattccatccatctgggatatatggttcaggttgtcttataacagagggg
gcaagaggtgaaggtgggtttttagtgaattcggaaggagagaggtttatggaaagatac
gctccatctgccaaagatttagcatgtagagacgtggtttcccgtgccattacaatggag
ataaacgaaggcagaggcgtcggtaccgagaaagaccatatgtatttgcaattgagtcat
cttcctgcatctgttttgaaacaaagattaccaggcatttcagaaactgctcatattttt
gctggcgttgatgtcactaaggagccaattcccatcttgccaactgttcactacaatatg
ggaggtatccccaccaactggcagggggaagttttaaagaaagatcatgagggcaaggat
aaagttgttcctggattgcttgcttgtggtgaagctgcctgtgcatctgttcacggtgca
aacagattgggtgccaattccttgttagacttggttgtttttggaagggctgtgtctcat
acgataagagataacctaactcctggaacttctttgcatgcatcaccagctgatttaggt
aagacttccattgaaaacttgcatagattgagaactgcagacggtacaaggtcgacagcc
gaaattagactagatatgcaaaaaacaatgcaaagaggttgtgccgtgtttagaacagaa
gaaacattggagaaatgcgttaaccatatcaatgacgttgacaaatcgtttgccgacgtt
aggactacagatcgttcaatgatttggaattctgacttggtggaaacaatggaactacag
aacttgttaacatgtgccacacaaacagcagcatctgcattagcaaggaaagaatcaaga
ggatctcattctcgtgaggattatcctgacagagatgatgtgaactggtggaagcatact
ttgtcttaccaaaacaacgttggttctgaagtaaagttggattatagagatgtgataaag
actacattggatactacagactgccaacctataccaccagctgttcgtaaatactag

DBGET integrated database retrieval system