KEGG   Candida dubliniensis: CD36_09690Help
Entry
CD36_09690        CDS       T01140                                 

Definition
(RefSeq) 1,4-alpha-D-glucan glucohydrolase, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cdu  Candida dubliniensis
Pathway
cdu00052  Galactose metabolism
cdu00500  Starch and sucrose metabolism
cdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CD36_09690
   00500 Starch and sucrose metabolism
    CD36_09690
Enzymes [BR:cdu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CD36_09690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Rotavirus_VP7 MF_alpha_N
Motif
Other DBs
NCBI-GeneID: 8045159
NCBI-ProteinID: XP_002417612
UniProt: B9W942
LinkDB All DBs
Position
1:2316621..2319461
Genome map
AA seq 946 aa AA seqDB search
MKLLSKLILATLGLSSIVSAAPTSSSSAEDAQKTVPLELSIGVKQLPNVHNDSAVDANAA
AKGYSLVNVTLTGRGLTGILKLKEATNIYGYDFEYLNLSVEYQSDKRLNVHIEPTDLTDV
FVLPEELVVKPKLEGDANTFNFESSDLVFEYDEEDFGFEVLRSSTREVLFSTKGNPLVFS
NQFIQFNTTLPKGHSITGLGESIHGSLNEPGVVKTLFANDIADPIDGNIYGVHPVYYDQR
YNTNTTHGVYWRTSAIQEVVVGETSLTWRALSGVIDLYFFSGPDPKDVIQQYVSEIGLPA
MQPYWALGYHQCRWGYDTVESLETVVENFKKFDIPLETIWSDIDYMDGYKDFTNDPHRFP
TDKFRKFLDDLHEKNQHYVPIFDAAIYVPNPNNATDNDYEPFHLGNESDIFLKNPDGSLY
IGAVWPGYTVFPDFLNNNTQEYWNKLFKDWYERIPFDGIWTDMNEVSSFCVGSCGTDRYY
DNPVHPPFEVGYSGSDYPLGFDKSNASEWKSISEAAAATATTTTTTSSASTSIDGKNTLA
PGKGNINYPPYAINNDQGDHDLATHAISSNATHADGTVEYDIHNIYGLIQERAIYEALLE
INPDKRPFMIGRSSFAGSGQYMGHWGGDNYADYYMMYFSIPQALSMGLSGIPFFGVDTCG
FNGNTDMELCSRWMQLASFFPFYRNHNVLGAIPQEPYVWEGVMNATKTSINVRYSLLPYY
YTLLHESHVTGIPIMRAFNWQFPYNKELAGVDTQFFVGDALLVTPVLEPGVNHTKGVFPG
ENAVYYDFYTHKKQEFTVGKNETLNAPLGHIPLHIKGGNIIPTQEPGYTTTESRKNPFGL
LVALDADGAASGKLYLDDGESVDVEEALYVDFVASKNKLVASVFGEYEASQPLANVTILG
VACEPNEVLFNGETVTHKYENGAVYVSDLQEFTKDGAFSEEFTIEW
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgttatcaaaactcattcttgcaactttgggtctctcttcaattgtcagtgct
gctccaacaagtagtagcagtgccgaagatgctcaaaaaactgttccccttgagcttagt
atcggtgtcaaacaacttccaaacgttcacaatgattcagctgttgatgctaatgctgct
gctaaaggttattcgttggtgaatgttactttaactggtagaggattgactggtattttg
aaacttaaagaagctaccaacatttatggttatgattttgaatatttgaacttgtccgtt
gaataccaaagtgataagagattgaacgttcatattgaacctactgatttaactgatgtt
tttgttttaccagaagaacttgttgttaaaccaaaacttgaaggtgatgctaacactttt
aattttgagagttccgatttggtttttgaatatgatgaagaagattttggatttgaagtt
ttgagaagctcgactcgtgaagttttgttctccactaaaggtaatccattggttttttct
aatcaattcattcaattcaataccactttgcctaaaggtcattcgattactgggttaggt
gaatccattcatggatctttgaatgaaccaggtgttgtcaagacattatttgctaatgat
attgctgacccaattgatggtaacatttacggtgttcatccagtatactacgatcaaaga
tataacacaaacacaacccatggtgtttattggagaacttcagctattcaagaagttgtt
gttggtgagacttctcttacttggcgtgctctttcaggtgttattgatctttatttcttt
agtggtccagatccaaaggatgttatccaacaatatgtctctgaaattgggttaccagcc
atgcaaccatactgggcattaggttaccatcaatgtagatggggttatgacactgttgaa
tcacttgaaactgttgttgaaaatttcaaaaaatttgatattcctttggaaaccatttgg
tcagatatagattatatggatggatacaaagatttcaccaacgatccacatagatttcca
actgataaattcagaaaattcttggatgatcttcatgaaaagaaccaacattatgttcct
atatttgatgctgcaatttatgttcctaacccaaataatgcaactgataatgactatgag
ccattccacttgggtaatgaatccgatatctttttgaaaaatcctgatggatcattatac
attggtgctgtttggccaggatacactgtattcccagactttttgaataataacactcaa
gaatattggaacaaattgttcaaagattggtatgaaagaattccttttgatggtatttgg
acagatatgaatgaagtcagttcattctgtgttggttcctgtggtactgatagatactac
gacaaccctgttcatccacctttcgaagttgggtattctggttctgattatccattaggt
tttgataaatctaacgcatctgaatggaaatctatttctgaagcagcagcagccactgca
accaccacaacaacaacatcttcagcttcaacatcaattgatggcaaaaacactttagcg
ccaggtaaaggtaatatcaactatccaccatatgcaattaacaacgatcaaggtgatcac
gatttagctacccatgcaatttcatctaatgccacccatgccgatggaacagttgaatac
gatattcacaatatttatggtctcattcaagaaagagccatttatgaggcattattggaa
atcaatcctgacaagagaccatttatgattggacgttcatcatttgctggatctggtcaa
tatatgggccactggggaggtgacaactatgctgattactacatgatgtacttttccatt
cctcaagctttgtcaatgggactttctggcatcccattctttggtgttgatacatgtggt
ttcaatggtaataccgatatggaattatgttctagatggatgcaattagcctcattcttc
ccattctacagaaaccacaatgttttgggtgctattccacaagaaccttatgtctgggaa
ggtgttatgaatgcaaccaagacatccattaacgtcaggtactctttgttgccatactat
tacactttgttgcacgaatcacatgttactggtattccaattatgcgtgctttcaactgg
caattcccttacaacaaagaattggcaggtgttgatactcaatttttcgttggtgatgca
ttgttggttacaccagtattggaaccaggtgtcaaccatactaaaggtgttttcccaggt
gaaaatgctgtgtactacgatttctacactcacaagaaacaagagtttactgttggtaag
aatgaaactttgaatgctcctttgggtcacattccattacacatcaaaggtggaaacatc
attccaactcaagaaccaggttacaccaccactgaatcaagaaagaatccatttggatta
ttggttgccttggatgctgatggtgcagcttctggtaaattgtatctcgatgacggtgaa
tccgtagatgttgaagaagcattgtacgttgactttgttgcatccaagaacaaattggtt
gcttctgtttttggtgaatatgaagcttctcaacctttagccaatgttacaattttgggt
gttgcttgtgaaccaaatgaagtattgttcaatggtgaaaccgttacccacaagtatgaa
aatggtgctgtctacgtttcagatttgcaagagtttacaaaggatggtgcattctcggaa
gagtttactattgaatggtaa

DBGET integrated database retrieval system