KEGG   Candida dubliniensis: CD36_10950Help
Entry
CD36_10950        CDS       T01140                                 

Definition
(RefSeq) glutamate decarboxylase, putative
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cdu  Candida dubliniensis
Pathway
cdu00250  Alanine, aspartate and glutamate metabolism
cdu00410  beta-Alanine metabolism
cdu00430  Taurine and hypotaurine metabolism
cdu00650  Butanoate metabolism
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
Module
cdu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CD36_10950
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CD36_10950
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CD36_10950
   00430 Taurine and hypotaurine metabolism
    CD36_10950
Enzymes [BR:cdu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CD36_10950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Topo_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 8045285
NCBI-ProteinID: XP_002417737
UniProt: B9W9G7
LinkDB All DBs
Position
1:2590630..2592336
Genome map
AA seq 568 aa AA seqDB search
MVLSKHIDALRLETQILKKTPQAQLRKDQFIDAFDSHKNIPQFEIPQNSSNEQLIYKYLS
QELSLDGVPTLNLASFVNTYVDGTSLKLIEDNLTKNLADNDEYPSLIDIQTRCISILSNL
WGAPGKVDNVTGNRVTNSIGTATTGSSEAIMLAGLALKKRWQLKRKAEGKSTANPNILMA
TCAQVALEKFACYFDVENRLIPVTEESGHLIDVSKIKENIDENTIGIFVIMGSTFTGAFE
PVEEISKLLDEVEKERGLDIRIHVDGASGGFVAPFIFPHLKWDFAVSRVDSINTSGHKFG
LTSVGLGWVIWKDADLLPKELRFSLDYLGGVEETFGLNFSRPGFPVITQYYNFLTLGRQG
YAKIFDGCMTNARLLSEFLEESKYFEVVSVIHHKLSESERKAQFTREVDDKHLDSKLYTI
NEDFKPGLPVVAFRFSKEFRDKYPELPQELLSTLLRKRGYIIPNYHLPPSENDKEILRVV
VRNSLSLNLLERLIQDITDATELLIKAADSITDYVSTSGEHTDVENRERIHKLLAAIASG
GVSEVKEEKHKKDNHKSGKNKKSYRGTC
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggttttaagtaaacacattgatgcattgagattggaaacgcaaattttgaagaaaact
ccacaagcccaattgcgtaaagatcaattcattgatgcatttgattcccacaagaacatt
cctcaatttgaaatcccacaaaactcatcaaatgaacaattgatttataaatatctttcc
caagaattatctcttgatggggtccccacattgaatttggcctcgttcgttaacacctat
gttgatggtacatctttgaaattaatcgaagataacttaaccaaaaacttggcggataac
gacgagtacccaagcttgatagatatacaaaccagatgtatatctattttaagcaacttg
tggggtgcccctgggaaagtagataatgtaactggtaaccgagtaactaattctattggt
acagccacaactggttcatctgaagctataatgttagctggattggctttgaagaaaaga
tggcaattgaaaagaaaagctgaaggtaaatctactgccaatccaaatatcttgatggct
acatgtgctcaagtcgccttggaaaaatttgcttgttattttgatgtagaaaacagatta
attcctgtcaccgaagaatctggtcatttgattgatgtttccaaaatcaaggaaaatatt
gatgaaaacacaattggcatttttgtaattatgggatctacctttactggtgcatttgag
cctgttgaagaaatttcgaaattattagatgaagttgaaaaagaacgtggattggatatc
agaattcatgttgatggagcatcgggtggatttgttgcaccatttattttcccccatttg
aaatgggattttgctgtctctagagttgattcgattaatacctctggtcacaagtttggg
ttgacttctgttggtttgggttgggtgatctggaaagatgctgatttgttgcccaaagag
ttgcgttttagtttggattatctcggtggtgttgaagaaacatttggcttaaatttctct
agacctggtttccctgtcattacccaatactacaactttttaactttaggcagacaaggg
tatgccaaaatctttgatgggtgcatgaccaatgctaggttgttgtcggaatttttggag
gaaagtaaatattttgaggttgtctcggttattcaccataaattgagtgaatcagaaaga
aaagctcaattcactagagaagtcgatgacaaacatttggattctaagctttatactatt
aatgaagatttcaagcctggtttgcctgtagttgcattcagattctccaaagagtttaga
gacaagtaccctgaattgcctcaagaattgttgtcaacattgttaagaaaaagaggttat
attattccaaactaccacttgcctccatctgagaacgacaaggagattttgagagttgtt
gttcgtaactcgttatctttgaatttgttggagagattaattcaagacatcaccgatgct
accgaacttttgatcaaagctgctgattccattactgattatgtttcaacaagtggtgag
cacactgatgttgaaaatagagaaagaattcataagttattggctgctattgcctctggt
ggtgtttctgaagtcaaagaagaaaaacacaagaaggataatcacaaatccgggaagaat
aaaaagtcttatcgtggtacttgttag

DBGET integrated database retrieval system