KEGG   Candida dubliniensis: CD36_17800Help
Entry
CD36_17800        CDS       T01140                                 

Gene name
CaLIG4
Definition
(RefSeq) dna ligase, putative
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
cdu  Candida dubliniensis
Pathway
cdu03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CD36_17800 (CaLIG4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cdu03400]
    CD36_17800 (CaLIG4)
Enzymes [BR:cdu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CD36_17800 (CaLIG4)
DNA repair and recombination proteins [BR:cdu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     CD36_17800 (CaLIG4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 BRCT RNA_ligase mRNA_cap_enzyme LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 8045817
NCBI-ProteinID: XP_002418257
UniProt: B9WAY7
LinkDB All DBs
Position
2:618662..621448
Genome map
AA seq 928 aa AA seqDB search
MTYFLNDIHPPSPNDITPTFTLLTKELFDKFDGVRKDSLGDFRTVTEKKAFIIKTFLNTF
RTHIGNDVYPSAKLIFPEKSGRIYFIKEVALARLLIKVYKIPKESEDYITLHDWNKSYQR
SRRFSIDEKKIRDLPLQASRIISKRRPIVDNVEEYTIPQINSSLDQLALEKSSQGQIDIL
KPLFDNLGIPEVRWLIHIILNKSILTNMERFFFNTWHPDGYRVFSICNDLQKAFQFSTNP
DLRLEPSQLAIHPCFKFKPQLSERLTTSYKTLVKKLQRKHEMDVPYEKKFQELGLENKFY
IEEKMDGDRMLLHKDGDSFKFFSRRLKDYSYLYGESFQFGALTKFLAHAFAGNVQSVILD
GEMVAYDYERNVILPFGTLKSSAIQESVRQFTTIDQYEQQTAYPFFLVFDVLFLNGKDLT
NYPLFFRKNILSRILRPIPNRFEVLDTRLGSSPEDIERAIREVVSSRCEGLVLKNVQSKY
EIDGFRNPDWIKVKPEYLEKFGENLDLVVIGKSPAIKNSYMCGLKSVTDGVYYSFCTCAN
GIEIEEFDKIERLTHGKWIKTDTTMPPESLIKFGTKIPTFWIHPSDSLVLEIRARSIDTR
AGTSYAVGSTLHNNHCRKIREDKTIDECVTLQEYTHIKANYINDLNKAQTALGKKRESMY
SLDNESKLKKVKVESDLFDGMEFLIMSDKREADGEVTTIEEMKAMVKSYGGKIVNSIDLA
TNYQIVVITERELPVSSQYLSKGIDLVKPIWIYECIQRGCVLQLEPYFIFASKNWDNFRN
MVDQYGDSYIIHHPLNIVVPNLSESELEELRNSFDWGELKPLIYLFKGLSFYVCGNNLSA
QFLKERIKRFSGDLSKHYTECCYIVIPDKHSRPLILSEIDKMSNQISREMVIDENGRSSR
IPYFVTEAFVQTSIKMNYIPDPEDYKFR
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgacatacttcttaaacgatatccacccaccttctccgaatgatatcactcccacattc
acattattgactaaagaattgtttgacaaatttgacggagttagaaaggacagccttgga
gattttcgaactgtcactgagaaaaaagcgtttataattaaaactttcttaaacacattt
cgaacgcatattggtaatgacgtatacccttcagcaaagctaatattcccggaaaagtcg
ggcagaatatacttcattaaagaagtggcattagcgcgtcttttgatcaaagtctacaag
atcccgaaagaatcggaggattacatcacgttgcacgattggaacaagctgtaccaaagg
tcaagacgattttccatcgatgagaaaaagattcgtgatttaccattgcaagcatcaagg
attatttccaaaaggagaccaattgtggataatgtcgaagaatataccataccacaaatc
aattcttctttggatcagttggcattggaaaagctgtctcaaggtcaaatagatattctt
aaacccttatttgataatctaggaattccagaagtaagatggctaattcatataatactt
aataaatcaattttaaccaacatggagaggttttttttcaacacttggcatccagatggc
tacagggtgtttagcatatgcaatgacttacagaaggcatttcagttttctacaaacccc
gatttgagactagaacctctgcaattggcaatacacccttgtttcaagtttaagccccag
ttgtcggaaagattgacgaccagttataaaacacttgtgaaaaagttgcaaagaaagcat
gagatggatgttccgtatgagaaaaaatttcaagaattgggattggaaaacaaattttac
attgaagagaaaatggatggcgatcgtatgcttcttcataaggatggtgacagcttcaag
tttttttcaagacgcttgaaagattactcttatttatacggagaaagtttccaatttggg
gctctaacgaaatttttagcgcacgcttttgctggaaatgtacaatctgttatactagat
ggtgaaatggtggcctatgattacgagcggaatgtaattcttccatttggaactttaaag
tcgctggctatccaagaaagtgttagacagttcacaactatcgaccaatatgaacaacag
acagcatatccatttttcctcgtgtttgacgttttgtttttgaatgggaaagatttaacc
aattatccattattcttccgcaaaaacattttgagtcgaatacttaggccaatacccaat
agatttgaagtcctagatacacgactaggttcttctccagaagatatcgaaagagcaatc
agggaagttgttagtagtcgatgcgaaggtctagtattgaagaacgtgcagctgaaatat
gaaattgatgggttcagaaacccagattggattaaagtcaaaccagagtatttagagaaa
tttggtgagaatttggatcttgtggtgattggcaagtctcctgccataaagaactcgtat
atgtgtggattgaaaagtgtaactgatggagtttattacagtttttgtacttgtgccaac
ggtatagagattgaggagtttgataaaatcgaaagacttactcatggaaagtggattaaa
acggatacaacaatgcctcctgagctgttgattaaattcggaactaaaattcccactttt
tggattcatcccagtgactcattagttttggaaattagagcccgttcaattgacacccga
gcgggtaccctgtatgctgttgggtcaacactacataacaaccattgccgaaaaattaga
gaggataaaactattgatgaatgtgtgacattacaggaatacacgcatatcaaagcaaat
tatataaatgatttaaataaggcacaaactgcattggggaagaagcgtgagtcaatgtac
tccttagataatgagctgaaattaaagaaagtgaaggttgagtctgatttgtttgatggg
atggagtttttgattatgagtgataaaagagaggctgatggtgaagttactaccattgaa
gagatgaaagcaatggttaaactgtatggcggaaaaattgtcaattcgattgatcttgcg
acaaactaccaaatagtggtgatcactgaacgagaacttccagtatccagtcaatatcta
agcaagggaattgacttggtgaaaccaatctggatatatgaatgcattcaaagaggatgt
gttcttcaactagaaccatatttcatatttgccagtaaaaattgggataattttagaaat
atggtcgatcaatatggagattcgtacattatacaccatccgttaaatattgttgttccc
aatctaagtgaaagtgaacttgaagagcttcgcaatagttttgactggggcgaacttaaa
cctttgatttatttgttcaaaggattatcattttatgtctgcgggaataacttgagtgcc
cagtttttaaaggaacgaattaagagatttagtggagatttgtcgaaacattatactgaa
tgttgttatatagtaatacctgataaacattccagaccattgatactttctgaaattgat
aagatgtcaaatcaaatttctcgtgaaatggttattgatgaaaatggtaggtcttcaaga
attccatattttgttactgaggcattcgtgcagacgtcaattaaaatgaattacattcct
gaccctgaagattacaagtttaggtga

DBGET integrated database retrieval system