KEGG   Candida dubliniensis: CD36_20310Help
Entry
CD36_20310        CDS       T01140                                 

Definition
(RefSeq) isocitrate dehydrogenase [nadp], mitochondrial precursor, putative
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cdu  Candida dubliniensis
Pathway
cdu00020  Citrate cycle (TCA cycle)
cdu00480  Glutathione metabolism
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
cdu01200  Carbon metabolism
cdu01210  2-Oxocarboxylic acid metabolism
cdu01230  Biosynthesis of amino acids
cdu04146  Peroxisome
Module
cdu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CD36_20310
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CD36_20310
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CD36_20310
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CD36_20310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 8046058
NCBI-ProteinID: XP_002418510
UniProt: B9WBP0
LinkDB All DBs
Position
2:complement(1210956..1212257)
Genome map
AA seq 433 aa AA seqDB search
MIRTTTTRTINRTAMLSKHIRGFSSTASILDKIKVKNPIVELDGDEMTRIIWQKIKDQLI
LPYLDVNLKYYDLGIESRDATNDQITIDAANAIKEHGVGVKCATITPDEARVKEFNLKKM
WLSPNGTIRNILGGTVFRESIIIPCIPRLIPGWKEPIVIGRHAFGDQYKATDLVITEPGK
LELRFTPASGGETQTHKVYDYTGPGVGLAMYNTDESISGFARASFNMALSKNLPLYMSTK
NTILKKYDGRFKDIFQDIYENEYASEFEKKGLWYEHRLIDDMVAQMIKSKGGFVMALKNY
DGDVQSDIVAQGFGSLGLMTSALMTPDGKAYEAEAAHGTVTRHYRQHQQGKETSTNSIAS
IFAWTRGLAQRGRLDETPEVVDFANTLEKATIDTVEVDRIMTKDLALAMGKTDRSAYVTT
TEFLDAVADRLKK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattagaacaactactacaagaactatcaaccgtacagccatgttgctgaaacacatt
cgtgggttttccagtaccgcttcaattttagataagatcaaagtgaaaaaccccattgtc
gaattggacggggatgaaatgactcgtattatttggcaaaaaatcaaagatcaattgatc
ttgccgtacttggatgtcaacttgaaatattatgatttaggaattgagtctcgtgatgcc
actaacgaccagatcaccattgatgcggcaaacgcaattaaagaacatggtgtcggtgtc
aaatgtgcaacaatcacccccgacgaagctagagtcaaggaattcaacttgaagaaaatg
tggctttctccaaatggtactattagaaatattcttggtggtactgtatttagagaatca
attattatcccatgcattccaagattgattcctggatggaaagaaccaattgttataggt
agacatgcctttggggatcaatataaagctactgatttagtcattactgagccaggtaaa
ttggaattgagattcactccagccagtggtggggaaacccaaactcataaggtctacgat
tacaccggtcccggggtcggattagccatgtataacaccgacgagtctattagtggcttt
gctcgtgcctccttcaacatggcattgtccaagaacttgccattgtacatgtcaaccaag
aacactattttgaaaaaatacgatggtagatttaaggacattttccaagacatttatgaa
aatgaatatgccagcgaatttgaaaagaaggggttgtggtatgaacacagattgattgac
gatatggttgctcaaatgatcaagtccaaaggtggatttgttatggcattaaagaattat
gatggtgatgttcaatcggatattgttgctcaaggttttggatcattaggtttaatgaca
tctgcattgatgactccagatggcaaagcttatgaagctgaagctgcccacggtaccgtc
accagacactacagacaacaccaacagggtaaagagacctccaccaactcaattgcatcc
atatttgcctggacaagaggattggcccaaagaggtagattggacgagacaccagaagtc
gttgactttgcaaacacacttgaaaaagccaccattgacactgttgaagtagatcgtatc
atgaccaaagatttagctttggccatgggtaaaaccgacagatccgcatatgttaccact
actgagtttttggatgctgttgctgatagattgaagaaataa

DBGET integrated database retrieval system