KEGG   Candida dubliniensis: CD36_20930Help
Entry
CD36_20930        CDS       T01140                                 

Definition
(RefSeq) conserved oligomeric Golgi complex component, putative
  KO
K20295  conserved oligomeric Golgi complex subunit 8
Organism
cdu  Candida dubliniensis
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cdu04131]
    CD36_20930
Membrane trafficking [BR:cdu04131]
 Endosome - Golgi transport
  Tethering complex
   Conserved oligomeric Golgi (COG) complex
    CD36_20930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dor1
Motif
Other DBs
NCBI-GeneID: 8046116
NCBI-ProteinID: XP_002418571
UniProt: B9WBV2
LinkDB All DBs
Position
2:1354107..1355360
Genome map
AA seq 417 aa AA seqDB search
MSSLLLETLQEGLDDEYIQLLNSDSTFAQDAEKYLSELLVNDDLLSTDPYTTASGESSYH
KKTLTEEIAELDMSQHEINAKLSTITNSNRDLIIDISNDLQFINHQITKEYSHHTENLVK
SITGEFRIDLSTSNHFNLKTNVSINNTILNNIDSVLDILELPTLCKLCILQGNYQESLEI
STYIQSLMIRYPKITLFKTINEQIDYELKVMIKGLIKLLNTNLKQNHILKIFQILHKLFD
DNENQIIDNESILIKIFLNSRFKFIINEISSLKPLIKFNKLTYLKRYIEIYREFMFNSLS
IYNIIFKNKNKSQHKQKQKQIILINQFIQSLVKLLCQEFKQYLPDIKTKKIDDSIESEFE
LKSSIDGLILQLIYLCRSLTGFGLDFEPIILLELVCDDLIPESDWLRNLSKVKIKNR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgttacttttagaaacattacaagaaggactagatgacgaatatattcaattg
ttgaatctggattcaactttcgctcaagatgcagaaaaatatttactggaattattagtc
aatgacgatttgttatcaactgatccatatactactgcttctggtgaatcatcatatcac
aaaaaaacattaactgaagagattgccgaattggatatgtctcaacatgaaatcaacgcc
aaacttagtacaatcaccaatagtaatcgagatttaattattgatattagtaatgattta
caatttatcaatcatcaaataactaaagaatacagtcaccatactgaaaatttagtgaaa
agtataactggtgaatttagaatcgatttatcaacctcaaatcattttaatttaaaaacc
aatgttagtataaataataccattttaaataatattgattcagttttggatattttggaa
ttaccaacattatgtaaattatgtatattacaagggaattatcaagaaagtttagaaatt
tcaacttatattcaaagtttaatgattagatatcctaaaatcacattatttaaaaccata
aatgaacaaattgattatgaattgaaagtgatgattaaaggtttaattaaattattaaac
accaatttaaaacaaaatcatattttaaaaatatttcaaatattacataaattatttgat
gataatgagaatcaaattattgataatgaatcaatattaataaaaatctttttaaattca
agatttaaatttattattaatgaaatttccagtttaaaaccattaataaaattcaataaa
ttaacatatttgaaaagatatattgaaatataccgtgaatttatgtttaattcattatcc
atatataatataattttcaaaaataaaaataaaagtcaacacaaacagaaacagaaacaa
atcattttgataaatcaatttattcaaagtttagttaaacttttatgtcaagaatttaaa
cagtatttacctgatatcaaaactaagaaaattgatgattctattgaatcggaatttgaa
ttgaaaagttcaatagatggattgattttacaattgatttatctttgtcgatcattgact
gggtttggattagatttcgaacctataattttattagaattggtatgtgatgatcttata
cctgaatcagattggttaaggaatttatctaaagtaaagattaagaataggtaa

DBGET integrated database retrieval system