KEGG   Candida dubliniensis: CD36_42210Help
Entry
CD36_42210        CDS       T01140                                 

Definition
(RefSeq) Cu, Zn, superoxide dismutase, putative
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cdu  Candida dubliniensis
Pathway
cdu04146  Peroxisome
cdu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CD36_42210
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    CD36_42210
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CD36_42210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 8047480
NCBI-ProteinID: XP_002419886
UniProt: B9WFT2
LinkDB All DBs
Position
4:complement(join(472170..472621,472883..472895))
Genome map
AA seq 154 aa AA seqDB search
MVKAVAVVRGDSKVQGIVRFEQESESAPTTISWEIEGNDPNALRGFHIHQFGDNTNGCTS
AGPHFNPFGKQHGAPEDDDRHVGDLGNISTDANGVAKGTKQDLLIKLIGKDSVLGRTVVV
HAGTDDYGKGGFEDSKTTGHAGARPACGVIGLTQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagctgtcgctgttgtcagaggtgattctaaagtccaaggtattgttcgtttt
gaacaagaatccgaatccgcaccaaccacaatttcttgggaaattgaaggtaatgatcca
aatgccttgagaggattccatattcatcaatttggtgataataccaatggttgtacttct
gctggtcctcatttcaatccatttggtaaacaacatggtgctccagaagatgatgacaga
cacgttggtgatttaggtaatatttctaccgatgccaatggtgttgctaaaggtactaaa
caagatttattgatcaaattgattggtaaagattctgttttaggtagaaccgttgttgtt
catgctggtactgatgattatggtaaaggtggatttgaagattctaaaaccactggtcat
gctggtgctagaccagcttgtggtgtcattggtttgactcaatga

DBGET integrated database retrieval system