KEGG   Candida dubliniensis: CD36_46090Help
Entry
CD36_46090        CDS       T01140                                 

Definition
(RefSeq) flavoprotein subunit of succinate dehydrogenase, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cdu  Candida dubliniensis
Pathway
cdu00020  Citrate cycle (TCA cycle)
cdu00190  Oxidative phosphorylation
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
cdu01200  Carbon metabolism
Module
cdu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cdu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CD36_46090
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CD36_46090
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CD36_46090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 8047624
NCBI-ProteinID: XP_002420252
UniProt: B9WF19
LinkDB All DBs
Position
4:complement(1516625..1518550)
Genome map
AA seq 641 aa AA seqDB search
MLTSFRNQVRSSAVTKRLLSSSSVRSQVIGSNVKGQDFNAAKYMSQKYHVVDHEYDCVVV
GAGGAGLRAAFGLVSEGFKTACVSKLFPTRSHTVAAQGGINAALGNMHPDDWHWHFYDTV
KGSDWLGDQDAIHYMTKEAPASIYELEHYGVPFSRNDEGRIYQRAFGGQSKEFGKGGQAY
RTCAVADRTGHALLHSLYGQSLRHDCHFFIEFFAMDLMMKDGACIGIIAYNEEDGTLHRF
FANRTIMATGGYGRAYFSCTSAHTCTGDGYAMVSRAGLPLEDLEFVQFHPSGIYGSGCLI
TEGARGEGGFLVNSEGERFMERYAPSAKDLASRDVVSRAITMEINEGRGVGPEKDHMYLQ
LSHIPAPVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTNWKGEVLKKSAD
GNDEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVAHTIRDNLQPGTPIPDHAK
DIGYESIANLDKLRNANGSKPTADIRLEMQKTMQKGCAVFRTQETLDQCVEHIGEVDKSF
EDVKTTDRSMIWNSDLVETLELQNLLTCATQTAASAAARTESRGAHSRDDFPDRDDVNWR
KHTLSYQETVGGPVRLDYRDVVKTTLDENDCKPVPPAKRVY
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgttgacttcattccgtaatcaagtgagaagctcagcagtgacaaagagattattatct
tcatcttcagttagatctcaagttattggatcaaatgtcaaaggtcaagatttcaatgct
gccaagtatatgagccaaaaataccatgtcgttgaccacgaatatgactgtgttgtcgtt
ggtgctggtggtgctggtttgagagcagcttttggtttagtctctgaaggtttcaaaacc
gcttgtgtttctaaattgttcccaaccagatcacatactgttgctgctcaaggtggtatt
aatgctgctttgggtaatatgcacccagatgactggcattggcatttctatgataccgtt
aaaggttctgattggttaggtgaccaagatgctattcattacatgaccaaagaagctcca
gcttctatttatgaattggaacattatggtgtcccattctctagaaatgatgaaggtaga
atttatcaaagagcctttggtggtcaatctaaagaatttggtaaaggtggccaagcttac
agaacttgtgctgttgccgatagaactggtcatgccttgttgcattccttatatggtcaa
tccttgagacacgactgtcatttcttcattgaattcttcgccatggatttgatgatgaaa
gatggtgcttgtattggtatcattgcttataatgaagaagatggtactttgcacagattc
tttgctaacagaaccattatggctactggtggttacggtagagcttacttctcttgtact
tctgctcacacttgtactggtgatggttacgctatggtttctagagctggtttgccttta
gaagatttggaattcgttcaattccatccatctggtatttatggttccggttgtcttatt
actgaaggtgctagaggtgaaggtggtttcttggtcaactctgaaggtgaaagatttatg
gaaagatacgctccatctgccaaagatttagcttccagagatgttgtttctagagctatt
actatggaaattaacgaaggcagaggtgttggtccagaaaaggatcacatgtacttacaa
ttgagtcatattccagctccagtgttgaaagaaagattaccaggtatttctgaaactgcc
cacattttcgccggtgttgatgttactaaagaaccaattcctatcttaccaactgttcat
tacaatatgggtggtattccaaccaactggaaaggtgaagttttgaaaaagagtgctgat
ggtaacgatgaagttgttccaggtttattagcttgtggtgaagctgcttgtgcttctgtc
cacggtgccaatagattgggtgctaactccttattggatttggttgtttttggaagagct
gttgctcacactattagagataatttgcaaccaggtactccaattccagaccacgctaaa
gatattggttatgaatcaattgccaacttggacaaactcagaaacgctaatggttccaaa
ccaactgctgatattagattagaaatgcaaaagactatgcaaaagggttgtgctgtgttt
agaactcaagaaactttggaccaatgtgtggagcatattggtgaagtggacaagagcttt
gaagacgtcaagactactgaccgttctatgatttggaactcagatttggttgaaacttta
gaattacaaaacttgttaacttgtgccactcaaactgctgcatcagctgctgctagaaca
gaatcaagaggtgctcattccagagacgatttcccagatagagatgatgttaactggaga
aaacacaccttatcttaccaagaaaccgttggcggtccagtgagattggattatagagat
gttgtcaagaccacattggacgaaaacgattgtaaaccagtcccaccagccaagagagtg
tattag

DBGET integrated database retrieval system