KEGG   Candida dubliniensis: CD36_80800Help
Entry
CD36_80800        CDS       T01140                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor, putative
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cdu  Candida dubliniensis
Pathway
cdu00020  Citrate cycle (TCA cycle)
cdu00310  Lysine degradation
cdu00380  Tryptophan metabolism
cdu01100  Metabolic pathways
cdu01110  Biosynthesis of secondary metabolites
cdu01130  Biosynthesis of antibiotics
cdu01200  Carbon metabolism
Module
cdu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cdu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CD36_80800
  09105 Amino acid metabolism
   00310 Lysine degradation
    CD36_80800
   00380 Tryptophan metabolism
    CD36_80800
Enzymes [BR:cdu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CD36_80800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N R2K_2
Motif
Other DBs
NCBI-GeneID: 8046810
NCBI-ProteinID: XP_002419028
UniProt: B9WD61
LinkDB All DBs
Position
3:178397..181387
Genome map
AA seq 996 aa AA seqDB search
MLRAFRSAVPRTQLLKSRLTILKTSVVGRRYLATDSFLQGSNSNYVDEMYEAWRQDPSSV
HASWNAYFKNIENDNIPPSKAFQAPPTIVPTVSGGAAGFYPGQSPISEDVVTHLKVQLLV
RAYQVRGHQKAKIDPLGISFGDNTTVPKELTLDYYGFTEQDLAKEITLGPGILPRFAQGG
KKSMTLKEIINFCEKTYCSSYGVEYVHIPSKEQCDWLRDRIEVPQPFKYSPDQKRQILDR
LIWATSFESFLSSKFPNDKRFGLEGAEAVVPGMKALIDTSVEYGVEDVVIGMPHRGRLNM
LSNFVRKPNESIFSEFTGSKEFDEGSGDVKYHLGMNYARPTTSGKHVNLSIVANPSHLEA
EDGVVLGKTRAIQQYKQDIGSFKKAMAVLLHGDAAFAGQGVVYETMGFANLPAYSTGGTI
HVIVNNQIGFTTDPRFARSTLYPSDIAKAIEAPIFHVNADDVEACTFVFNLAAEWRATYH
TDCIIDVVGYRKHGHNETDQPSFTQPLMYQEIAKKKSVIDIYEKQLIEEGTFTAEDINEH
KQWVWNILEDNFKKAKDYKPTSREWLTTPWEDFKSPKELATEVLPHLPTAVDEATLKKIG
NAISETPEGFEVHRNLKRILNARKKSVETGEGIDYATGEALAYGSLALEGYHVRVSGQDV
ERGTFSQRHAVLHDQNSESVWTPLSNLSEDQGAFNISNSSLSEYGVLGFEYGYSLTSPDA
LVEWEAQFGDFANTAQVVIDQFVAGAESKWKQRSGVVLSLPHGYDGQGPEHSSSRLERYL
QLCNEDQRFFPSPEKLERQHQDCNMQVAYPTTPANVFHLLRRQMHRQFRKPLILVFSKSL
LRHPLARSNLSEFTGDSHFQWIIEDVLGDKSEVKRVVLLTGQVYAAFHKKRASLDDKSTA
FIKIEQLHPFPYAQLRDALNEYPNLEDLVWTQEEPLNMGAYNFVAPRVEAVLGETQKYKD
LKLRYAGRDPSASVAAGSKAMHVAEEEEFLAETFRQ
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atgcttagagcttttagaagtgctgtacctcgtacacagcttttgaaatcacgcttaact
attctaaaaacttccgttgttggcagacgttatcttgctaccgattcattcttgcaaggg
tccaattccaactatgtcgatgaaatgtatgaagcttggagacaagatccatcaagtgtc
cacgcctcatggaatgcctacttcaagaacattgaaaatgataacatcccaccatccaag
gctttccaagctccaccaactattgtcccaacagtttcaggaggtgccgctggattctat
cctggccaaagtccaatttcagaagatgttgttacccatttgaaggttcaattgttagtt
cgtgcttaccaagttagaggtcatcagaaggctaaaattgatccattgggaatttctttt
ggcgacaacactactgttccaaaggaattgactttagactactatggtttcaccgaacag
gatttggctaaggaaattactttgggtcctggtattttaccaagatttgctcaaggtggt
aagaagagtatgaccttgaaagaaatcattaacttttgtgaaaaaacttactgctcctct
tatggtgttgagtacgtacacattccctcaaaggagcaatgtgattggttaagagacaga
atcgaggttcctcaaccattcaaatattctccagatcaaaaaagacagattttggatcgt
ttgatttgggccacctctttcgaatccttcttgtcaagcaagttcccaaatgacaagaga
tttggtttggaaggtgccgaagccgttgtcccaggtatgaaggctttaattgatacctcc
gttgaatacggtgtcgaagacgttgttattggtatgccacatagaggtagattgaatatg
ttgtccaattttgttcgtaaaccaaacgaatccatcttttctgaattcactggttccaaa
gaattcgatgaaggttcaggtgatgtgaagtatcatttgggtatgaattacgcaagacca
acaacttctggtaagcacgtcaacttgtctattgttgctaatccatcgcatttggaagcc
gaagatggtgttgtcttgggtaaaactcgtgcaattcaacaatacaaacaagacattggt
tctttcaaaaaggccatggctgtccttttacatggtgatgccgcatttgctgggcaaggg
gttgtttatgaaactatgggttttgctaacttaccagcatattctactggtggtactatt
catgtcattgtgaacaatcaaattggtttcaccactgatccaagatttgctagatcaact
ttgtatccatctgacattgccaaagccattgaagctccaattttccatgttaatgctgac
gacgtagaagcttgtacttttgtcttcaatttggccgctgaatggagagccacttaccac
accgactgtatcattgatgttgttggttacagaaagcacggtcataacgaaactgatcaa
ccatctttcacccaaccactcatgtaccaagaaattgccaaaaagaagtctgttattgac
atttacgaaaagcaattaattgaagaaggtacttttactgctgaagatatcaatgaacac
aaacaatgggtttggaatattttggaagacaacttcaagaaagccaaagactataaacct
acctctagagaatggttgacaactccttgggaagatttcaaatcaccaaaagaattggct
actgaggtcttaccacacttgccaactgctgttgatgaagctactttaaagaaaattggt
aatgccatttccgaaactccagaaggatttgaagtccacagaaacttgaaacgtattttg
aatgccagaaagaagagtgttgagaccggtgaaggtatcgattatgctactggtgaagcc
cttgcttatggttctttggctcttgaaggataccatgttagagtatcgggtcaagatgtt
gaaagaggtactttctctcaaagacatgctgttttgcacgatcaaaacagtgaatctgtg
tggacaccattgtccaatttgagtgaagaccaaggagctttcaatatttccaattcttct
ttgtcagaatatggtgttttagggtttgaatatggttactccttaacttccccagatgct
ttggttgagtgggaagctcaattcggtgatttcgcaaacactgcccaagttgttattgat
cagtttgttgctggtgctgaatcaaaatggaaacaaagatctggtgttgttttgtcattg
ccacacggttatgatggtcaaggtccagaacattcttcatccagacttgaaagatactta
caattatgtaatgaagaccaacgtttcttcccatcaccagaaaaattagaacgtcaacat
caagactgtaacatgcaagttgcctatccaaccaccccagccaacgttttccatctttta
cgtcgtcaaatgcatagacaattcagaaagccattgattttggtcttttctaaatcgtta
ttgcgtcatccattagcaagatcaaacttgtcagaattcactggtgattcccacttccaa
tggatcattgaagatgttttaggagacaaatcagaagtgaagagagttgtgttattgact
ggtcaagtttatgctgcttttcacaaaaagagagcttccttagatgacaaatcaactgct
ttcattaagattgaacaattgcatccattcccatatgctcaattacgtgatgccttgaat
gaatatccaaaccttgaagacttggtgtggacccaagaagaaccattgaacatgggtgct
tataactttgttgctccaagagtggaagctgttttgggtgaaactcagaaatacaaggac
ttgaaattgagatacgctggtagagacccaagtgcttctgttgcagctggttctaaggcc
atgcatgttgctgaagaagaagaattcttagcagaaacctttcgtcaataa

DBGET integrated database retrieval system