KEGG   Corynebacterium diphtheriae VA01: CDVA01_0164Help
Entry
CDVA01_0164       CDS       T01702                                 

Definition
(GenBank) putative secreted protein
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
cdv  Corynebacterium diphtheriae VA01
Pathway
cdv00550  Peptidoglycan biosynthesis
cdv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CDVA01_0164
Enzymes [BR:cdv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     CDVA01_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M
Motif
Other DBs
NCBI-ProteinID: AEX82433
LinkDB All DBs
Position
complement(169319..170581)
Genome map
AA seq 420 aa AA seqDB search
MSFNLRTRLAIGAAAVATTASRATGRGSGGMIGGLIAEKIDPNIMQSLAKRRPTALVTGT
NGKSTTTRMLASAVSAQHTVATNEGGDNMDAGIISALMAGQSASHVVLEVDELHVPSAAD
RLHPQCLILLNLTRDQLDRVGEINKIERALRDCVTAHPDMTVIANCDDVLVTSVAYDAPN
VVWVSAGAGWTGDSVSCPRTGSHIVRQDDHWYATKPLPNGETFQRPTPAWTITPDGILAP
GHVEPVPLSLALPGNANRGNATQAIAAAVTCFNVPLDDAVRAVETVDDVAGRYSTITLGE
HHIHLLLAKNPAGWQEALSMVDRTAEGLVIAVNGQVADGEDLSWLWDVKFEELEELSVKA
AGERGTDLSVRLTYASVDHELVRDPLAAIKACPAGRVEVLANYTAFRDLKRAITAATKEA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaatttgcgcactcgccttgcaatcggcgcggccgctgtggccactacggct
tcgcgggcgaccggccgtggctccggcggcatgattggtggtctgattgcagaaaaaatc
gacccgaatatcatgcagtcattggctaaaaggcgtccgaccgcgctcgtaacaggcacg
aatggcaagtccaccaccacgcgcatgctggccagcgccgtcagcgcccagcacaccgtg
gccaccaacgaaggtggcgacaacatggacgccggcattatctccgctctgatggcgggg
caatcggcaagccacgtggttcttgaagtcgatgagctgcacgttccgtcggcagccgac
cgcctccacccgcagtgcctgatcctgctcaacctcacccgcgaccagcttgaccgcgtc
ggcgagatcaacaagatcgaacgtgccctgcgcgactgcgtaaccgcacaccccgacatg
accgtgatcgccaactgcgacgacgtgctagtcacctccgtggcttacgacgcccccaac
gtagtctgggtatcagctggtgccgggtggaccggcgactccgtgtcctgcccacgcacc
ggcagccacatcgtccgccaagacgaccactggtacgccaccaagccactcccgaacggc
gaaaccttccagcgccccacccccgcgtggaccatcacccctgacggcattctcgcccca
gggcatgtcgaacccgtcccgctgtccctagcgctgccgggcaacgccaaccgtggcaac
gccacccaagccatcgctgcggccgtgacctgcttcaatgtgccgcttgatgatgctgtg
cgtgccgtcgaaacggtggacgatgtggcgggccgctactccaccatcaccctcggcgag
caccacattcacctgctgttggccaagaacccagccggctggcaagaggcgctctccatg
gtggatcgcaccgccgagggccttgtgatcgccgtgaacggccaagtcgctgatggcgag
gacctctcctggctttgggacgtcaagttcgaggagctcgaagagctttccgttaaggct
gccggcgagcgcggtacggacctctccgtgcgcctgacttacgcctccgtggaccacgag
ctcgtgcgcgaccccctcgccgccatcaaggcctgcccagcggggcgcgtcgaagtccta
gccaactacaccgcattccgcgatctcaagcgcgccatcaccgccgcaaccaaggaggct
taa

DBGET integrated database retrieval system