KEGG   Corynebacterium diphtheriae PW8: CDPW8_0040Help
Entry
CDPW8_0040        CDS       T01701                                 

Gene name
pknA
Definition
(GenBank) serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cdw  Corynebacterium diphtheriae PW8
Brite
KEGG Orthology (KO) [BR:cdw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cdw01001]
    CDPW8_0040 (pknA)
Enzymes [BR:cdw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CDPW8_0040 (pknA)
Protein kinases [BR:cdw01001]
 Serine/threonine kinases: Other
  Bacterial family
   CDPW8_0040 (pknA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Kdo Pkinase_fungal WaaY RIO1 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AEX68722
LinkDB All DBs
Position
complement(41725..43239)
Genome map
AA seq 504 aa AA seqDB search
MTQSQSPDPALQALVGSDYALQWVVGNGGMSTVWLADDLRNQREVAIKVLRPEFSDNEEF
LSRFRNEALASEHIDSDNVVRTYDYREVTDDMGRTLCFIVMEYVRGESLADMLARKGRLE
EDLALDVLEQAAHGLSIIHRMGMVHRDIKPGNLLITQNGQVKITDFGIAKAAAAVPLTRT
GMVVGTAQYVSPEQAQGRDVTAATDVYSLGVVGYEMLVGQRPFTGDSSVSVAIAHINQAP
PAMPTSVSAPARELIGIALRKDPAHRYADGNELALAVSATRMGQRPPQPKSAPLQHIAPQ
PAPTESTYALGATAQPTTVIPATGQVPAAPAAAAYPASTVIPADTPRQEPEKQSSGWGAG
IVVGALAALLLGTAAWAASQGMFDDLFDKTPQSSESSVPPPPVTATVTETPTPQITTVVP
EPLPTSSPEPTPSETKRTPDESHPSSDHQLPSVRPSHNGRPSSQAPHAPHAPTQDADQPA
ESPAPDTLDSLIENLNKLNQGGAQ
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacacaatcacagtcacctgatccggcactgcaggcgctcgtcggttccgactacgcc
ttgcaatgggtggtgggcaacggcggaatgtccacggtttggcttgccgacgacctccgc
aaccaacgcgaagtggccatcaaggtgttgcgcccagaattctccgacaacgaagaattc
ctctcacgcttccgcaacgaggcactcgccagcgagcacatcgactccgacaacgtggtg
cgcacttacgactaccgcgaagtcaccgacgacatgggccgcaccctgtgcttcatcgtg
atggaatacgtccgcggcgaatccctcgccgacatgctggcacgcaaaggtcgcctcgaa
gaagaccttgctctcgacgttctcgagcaggcagcccacgggctatccatcatccatcgc
atgggcatggtccaccgcgacatcaaacctggcaaccttttgatcacccaaaacggccag
gtaaaaattactgacttcggtatcgccaaagcagccgcagcagtaccactgacgcgaacg
ggcatggtggtgggcaccgcccagtatgtctccccagagcaggcacagggccgcgatgtt
accgcagctaccgacgtctactccctaggcgttgtgggatacgagatgctggtgggtcag
cgccccttcaccggcgactcctcggtttccgtggctatcgcccacatcaaccaagcccca
ccggctatgccaactagcgtgtccgccccggcgcgcgagctgatcggcattgcgctgcgc
aaggatccggcacaccgttatgccgatggcaacgagctggcgttggcggtttctgctacc
cgtatggggcagcgcccgccacagcctaagtcggcaccattgcagcacattgcgccgcag
ccggctcccacggaatccacctatgcgttgggtgctactgcgcaaccgacgacggttatt
ccggctaccggccaagtgcctgccgctcccgctgctgctgcgtatccggcatcgacggtg
attcctgctgacacgccacgccaagagccggagaagcaatctagtggttggggtgccggc
attgtggtcggcgcgttggctgcattgttgttgggtactgctgcgtgggctgcaagtcag
ggcatgtttgatgatctttttgataagacgccgcaaagctcggagtcctcggttccgccg
ccacctgtgacggctaccgtgacggagactcccacaccgcagatcaccactgtggtccca
gagccgttgcctacgtcgagcccggagccaactccgagtgaaacgaagcgtacgcctgac
gagtcgcacccatcgtcggatcaccagttgccttcggtgcgcccgtcgcataatggtcgc
cccagctctcaagcgccacatgcaccacatgcgcctacgcaggatgctgatcagcctgcc
gaatcacctgctcccgatactctcgattctttgatcgagaatctgaacaagctcaaccaa
ggaggtgcccagtga

DBGET integrated database retrieval system