KEGG   Corynebacterium diphtheriae PW8: CDPW8_0458Help
Entry
CDPW8_0458        CDS       T01701                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cdw  Corynebacterium diphtheriae PW8
Brite
Translation factors [BR:cdw03012]
 Eukaryotic Type
  Elongation factors
   CDPW8_0458 (tuf)
 Prokaryotic Type
   CDPW8_0458 (tuf)
Mitochondrial biogenesis [BR:cdw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CDPW8_0458 (tuf)
Exosome [BR:cdw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CDPW8_0458 (tuf)
  Exosomal proteins of breast cancer cells
   CDPW8_0458 (tuf)
  Exosomal proteins of colorectal cancer cells
   CDPW8_0458 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEX69120
LinkDB All DBs
Position
461557..462747
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPELNEAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEIRELLAEQDYDEEAPIIHISALKAL
EGDEKWTQSIIDLMQACDDSIPDPERETDKPFLMPIEDIFTITGRGTVVTGRVERGSLKV
NEDVEIIGIREKATTTTVTGIEMFRKLLDYTEAGDNCGLLLRGVKREDVERGQVVVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggctaagttcgagcgtaccaagccgcacgtcaacatcggcaccatcggtcac
gttgaccacggtaagaccaccaccaccgctgctatcaccaaggttttggcagacgcttac
ccagagctgaacgaagctttcgctttcgatgccatcgataaggcaccggaagagaaagag
cgtggtattaccatcaacatctcccacgtggagtaccagaccgagaagcgccactacgca
cacgttgacgctccaggtcacgctgactacatcaagaacatgatcaccggtgctgctcag
atggacggcgcaatcctcgttgttgctgccaccgacggcccaatgcctcagacccgtgag
cacgttctgctcgctcgccaggtcggcgttccttacatcctcgttgctctgaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggagatccgtgagctgctc
gctgagcaggattacgacgaagaggctccaatcatccacatctccgcactgaaggctctt
gagggcgacgagaagtggacccagtccatcatcgacctcatgcaggcttgcgatgattcc
atcccagacccagagcgtgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggccgcggtaccgttgttaccggccgtgttgagcgtggctccctgaaggtc
aacgaggacgtcgagatcatcggtatccgcgagaaagctaccaccaccaccgttaccggt
atcgagatgttccgtaagcttctcgactacaccgaggctggcgacaactgtggtctgctt
ctccgtggcgttaagcgcgaagacgttgagcgtggccaggttgttgttaagccaggcgct
tacacccctcacaccgagttcgagggctctgtctacgttctgtccaaggacgagggtggc
cgccacaccccattcttcgacaactaccgcccacagttctacttccgcaccaccgacgtt
accggtgttgtgaagcttcctgagggcaccgagatggtcatgcctggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgctatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgtcggcgctggtcgcgttaccaagatcatcaagtaa

DBGET integrated database retrieval system