KEGG   Corynebacterium diphtheriae PW8: CDPW8_0566Help
Entry
CDPW8_0566        CDS       T01701                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
cdw00473  D-Alanine metabolism
cdw01100  Metabolic pathways
cdw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cdw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CDPW8_0566 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CDPW8_0566 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdw01011]
    CDPW8_0566 (alr)
Enzymes [BR:cdw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CDPW8_0566 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cdw01011]
 Precursor biosynthesis
  Racemase
   CDPW8_0566 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEX69228
LinkDB All DBs
Position
564252..565400
Genome map
AA seq 382 aa AA seqDB search
MNLLETRISCEAIAANTRRLKDMVAPAQLMCVVKADGYNHGAPEVATVMARNGADQFGVA
TLAEAHQLRDAGITLPILCWIWSPEQDFSAAIDRDIDLAAVSMEHVRALIAEAMRRPAGT
RVRVTVKIDTELHRSGIDEANWTEAFELLHACPQINVTGVFSHLACADDLESDYTDHQAE
VFRRAIDAGRRVGLDLPVNHLAASPATLTRPDLHFDMVRPGLALYGHEPMAGLDHGLREA
MTWVGAVTVVKPIAAGQGTSYNMTWHAPADGYLCVVPVGYADGLPRNVQGHLEVTIAGTR
YPQVGRVCMDQIVVFLGDNSRGVAPGDEAIIFGPRDTQAMTATELACATGTINYEILCRP
TGRSHRTYSALDAVAPTHPTES
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgctcgaaactcgcatctcgtgcgaagccattgctgcgaacacgcgacgttta
aaagacatggttgctcccgctcagctcatgtgtgttgtaaaagctgacggctacaatcac
ggtgccccagaagttgctactgtgatggcgcgtaacggtgccgaccaatttggtgtcgca
acgcttgcggaagcacatcagctacgagacgcgggtattaccctccccatcctgtgctgg
atctggtcacccgagcaggacttttccgccgccattgaccgtgacatcgacttagccgcc
gtcagcatggaacacgttcgtgcactgatcgcggaggctatgcgtcgtcccgcaggtacc
cgagtgcgggtgaccgtgaaaattgacacggaacttcaccgatctggaatcgacgaagca
aactggacagaagcctttgagctgcttcatgcctgcccccaaatcaacgtcacgggcgta
tttagtcacttggcatgcgcagacgacttggaatcggactacaccgaccaccaagcagaa
gtattccgcagggcgattgatgcaggtagacgcgtaggacttgaccttcctgttaatcat
ctagcggcatcaccagcaacactaacccgccccgacttgcactttgacatggtccggcct
gggcttgccctctatggtcatgaaccgatggcaggactcgaccatgggctgcgcgaagcc
atgacatgggtaggggccgtcacggtagtcaaacccatcgcagccggtcagggaacaagc
tacaacatgacatggcatgcgcccgcagatggctacctctgcgtggtgccggttggttat
gcggacggattaccgcgcaacgtacaaggacatttagaagtaacgatcgccggcacgcgc
tacccacaagtaggccgtgtttgtatggaccagattgtggtattccttggcgataattcc
cgcggtgttgcccctggtgatgaggcaattatttttggcccaagagatacccaagcgatg
acagcgacggagctggcctgcgctacgggaaccatcaactatgaaatcttgtgccgccct
accggacgaagccatagaacctatagtgctcttgacgccgttgcgcccacgcaccctact
gaaagctga

DBGET integrated database retrieval system