KEGG   Corynebacterium diphtheriae PW8: CDPW8_2333Help
Entry
CDPW8_2333        CDS       T01701                                 

Gene name
trpG
Definition
(GenBank) anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
cdw  Corynebacterium diphtheriae PW8
Pathway
cdw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdw01100  Metabolic pathways
cdw01110  Biosynthesis of secondary metabolites
cdw01130  Biosynthesis of antibiotics
cdw01230  Biosynthesis of amino acids
cdw02024  Quorum sensing
Module
cdw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDPW8_2333 (trpG)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    CDPW8_2333 (trpG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CDPW8_2333 (trpG)
Enzymes [BR:cdw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CDPW8_2333 (trpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: AEX70976
LinkDB All DBs
Position
2501658..2502278
Genome map
AA seq 206 aa AA seqDB search
MLLDNHDSFVYNLVDAFAVAGYRCTVLRNSVTVTEVLDLEPALICLSPGPGHPREAGCMM
DLIGASIGTIPILGICLGFQALLEHHGGEVRPCGPVHGTTDLMTLTNPDHPLFAGLSIDA
TPNNNFHGTQVPIARYHSLGCTDIPPNMVSLGTCDSAIGPVTMAAETHDSEGQITSIGLQ
FHPESVLSPSGPIILERCVDKLLANK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgctccttgataaccacgactcttttgtttacaacctagtggacgcttttgccgtcgcc
ggttaccgctgcacagtcctacgcaatagcgtcactgtgacagaagttcttgacctagaa
cccgccctcatttgtctctccccaggacctggtcacccccgcgaagccggctgcatgatg
gacctcatcggggcgtcgataggcaccatcccgatcctcggcatctgcctcggcttccaa
gcactcctcgaacaccacggtggggaagtccgcccctgcggccccgtccacggcaccacc
gacctcatgacgctcaccaacccagaccatccactgttcgcaggacttagcatcgacgcc
acacccaacaacaacttccacggaacacaggtgcccatcgcacgctatcactccctagga
tgcaccgacatcccaccaaacatggtgagcctaggaacctgcgactccgccatcggacct
gtcaccatggccgccgaaacccacgacagcgaggggcagatcaccagcattggattgcaa
ttccaccccgaatccgtactaagccccagcgggcccatcatcctcgaacgatgcgtcgat
aaactgctagccaacaaataa

DBGET integrated database retrieval system