KEGG   Corynebacterium deserti: CDES_06385Help
Entry
CDES_06385        CDS       T04068                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cdx  Corynebacterium deserti
Pathway
cdx00473  D-Alanine metabolism
cdx00550  Peptidoglycan biosynthesis
cdx01100  Metabolic pathways
cdx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cdx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CDES_06385 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CDES_06385 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CDES_06385 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdx01011]
    CDES_06385 (ddl)
Enzymes [BR:cdx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CDES_06385 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:cdx01011]
 Precursor biosynthesis
  Amino acid ligase
   CDES_06385 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: ALC05699
UniProt: A0A0M3Q9H3
LinkDB All DBs
Position
1305929..1307014
Genome map
AA seq 361 aa AA seqDB search
MSNSNSGKIRVAVIYGGRSSEHSVSCVSAGAIMAHLDPEKYEVIPVGITVDGAWVVGESN
PQRLTLVDRTMPEVEHREEVRPSLDPAHRGEFHFSDGSLYATADVIFPVLHGRFGEDGTI
QGLFALSDIPVVGPGVLSSAAGMDKEFTKKLMAAEGLPIGKEVILRDRTELTEAEKNLLG
LPVFVKPARGGSSIGISRVKTWEEFPKAVELARAHDEKVIVESEIVGSEVECGVLQYPDG
RIVASEPALLLGTEDGAGGFYDFDTKYLDNVVTAEIPASLDQKTTELIKSLAIESFQALS
CEGLARVDFFVTANGPVLNEINTMPGFTPISMYPQMFAASGVGYEELLDVLIQQALHRSA
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaactcaaattctggaaaaatccgcgtcgccgtcatctacggtggccgtagttct
gagcactctgtctcctgcgtatccgctggtgccatcatggcgcatttggatccagagaag
tatgaggtgattcctgtcggcatcacggtcgatggtgcgtgggtagtgggtgaaagcaac
ccacagaggctgacgctggtggatcgcacgatgccggaggttgagcatcgtgaagaggtt
cgaccaagtttggatcctgctcatcgcggtgaattccacttctctgatggcagcttgtac
gccaccgctgacgtcattttccctgtgttgcatggtcgtttcggtgaggacggcaccatc
cagggtctgtttgctctgtccgatattccggttgttggccctggcgttttgtcctcggct
gcgggtatggataaagaattcacgaaaaagctcatggctgctgaaggcctgcccatcggt
aaggaagttatccttcgcgatcgcacagagttgaccgaggcagagaagaacctcctgggt
ctgcctgtgtttgtgaagcctgctcgtggcggttcctcgattggtatttctcgagtgaag
acgtgggaggagttccctaaggctgtggagcttgctcgcgctcacgatgaaaaggtgatc
gtggagtcggagatcgtcggttcagaggtggagtgcggcgtgctgcagtacccagatggt
cgcatcgttgcttctgagcctgcgttgttactgggcactgaggacggcgctggtggattc
tacgactttgataccaagtacttggacaacgtggtcaccgcagagatcccagcttcgctt
gatcaaaagaccaccgagctgattaagtcgttggccattgagtcgttccaggcattgtct
tgtgaaggccttgcccgcgtggacttctttgttaccgctaacggccctgtgctcaatgag
atcaacaccatgcccggtttcacgccgatctccatgtacccgcagatgttcgcggcctcc
ggcgtgggttatgaggaacttctcgacgttctcatccagcaggcactccaccgttcagca
cagtag

DBGET integrated database retrieval system