KEGG   Corynebacterium deserti: CDES_08530Help
Entry
CDES_08530        CDS       T04068                                 

Gene name
ppgK
Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cdx  Corynebacterium deserti
Pathway
cdx00010  Glycolysis / Gluconeogenesis
cdx00520  Amino sugar and nucleotide sugar metabolism
cdx01100  Metabolic pathways
cdx01110  Biosynthesis of secondary metabolites
cdx01120  Microbial metabolism in diverse environments
cdx01130  Biosynthesis of antibiotics
cdx01200  Carbon metabolism
Module
cdx_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDES_08530 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    CDES_08530 (ppgK)
Enzymes [BR:cdx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CDES_08530 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ALC06099
UniProt: A0A0M3Q9Q2
LinkDB All DBs
Position
1737813..1738565
Genome map
AA seq 250 aa AA seqDB search
MTQTGFGIDIGGSGIKGAVVDMETGEFIGERIKIATPKPATPEAVAEVVAEIVAQAEWDG
PVGITLPSVVRGQIALSAANIDKSWIGTDVHELFDRHLGGREITVLNDADAAGIAEATFG
NPAAREGAVILLTLGTGIGSAFLIDGVLFPNTELGHLIVDGDEAEHLASAAVKESEDLSW
KKWTKRLNAVLEEYEKLFSPSVFIIGGGISRKHEKWLPLVEIDTDVVPAELRNRAGIVGA
AMAVAKHLAP
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaactggatttggaattgatatcggtggttctggcatcaaaggcgccgtagtg
gacatggaaaccggtgagttcatcggtgagcgcataaaaatcgctacccctaaaccagct
acacctgaagctgtcgccgaagtcgtggctgagattgtcgcgcaagcagagtgggacggc
cccgtcggcatcaccctcccttccgtggtgcgcgggcagattgcgctgtcggccgcaaat
attgataaatcctggatcggcaccgacgtgcacgaactttttgaccgccaccttggtggg
cgggaaataaccgtgcttaacgacgccgacgctgccggcattgcggaagccaccttcgga
aacccggccgcacgcgagggcgcagttattttgctcacgctcggcacaggcattggttct
gccttcctcatcgatggtgtgctgttccctaacactgagctcggccacctcatcgtcgac
ggcgacgaagccgaacatctcgcctccgctgcggtgaaggaaagcgaagacctgtcgtgg
aagaaatggaccaaacgcctcaacgcagtgctggaggagtatgaaaaacttttctccccg
tcggtgttcatcatcggtggtggcatttcccgcaaacacgaaaaatggttaccgctagtt
gagatcgacaccgacgttgtgcccgctgaactgcgaaaccgcgcaggaatcgtgggggca
gcaatggctgtggcaaagcacctcgcaccgtaa

DBGET integrated database retrieval system