KEGG   Corynebacterium diphtheriae 31A: CD31A_0823Help
Entry
CD31A_0823        CDS       T01697                                 

Gene name
echA2
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
cdz00071  Fatty acid degradation
cdz00280  Valine, leucine and isoleucine degradation
cdz00310  Lysine degradation
cdz00360  Phenylalanine metabolism
cdz00362  Benzoate degradation
cdz00380  Tryptophan metabolism
cdz00410  beta-Alanine metabolism
cdz00627  Aminobenzoate degradation
cdz00640  Propanoate metabolism
cdz00650  Butanoate metabolism
cdz00903  Limonene and pinene degradation
cdz01100  Metabolic pathways
cdz01110  Biosynthesis of secondary metabolites
cdz01120  Microbial metabolism in diverse environments
cdz01130  Biosynthesis of antibiotics
cdz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cdz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CD31A_0823 (echA2)
   00650 Butanoate metabolism
    CD31A_0823 (echA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CD31A_0823 (echA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD31A_0823 (echA2)
   00310 Lysine degradation
    CD31A_0823 (echA2)
   00360 Phenylalanine metabolism
    CD31A_0823 (echA2)
   00380 Tryptophan metabolism
    CD31A_0823 (echA2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CD31A_0823 (echA2)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CD31A_0823 (echA2)
   00281 Geraniol degradation
    CD31A_0823 (echA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CD31A_0823 (echA2)
   00627 Aminobenzoate degradation
    CD31A_0823 (echA2)
   00930 Caprolactam degradation
    CD31A_0823 (echA2)
Enzymes [BR:cdz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CD31A_0823 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEX41502
LinkDB All DBs
Position
815917..816693
Genome map
AA seq 258 aa AA seqDB search
MAQVEVRIDGHLMCVTLNRHEARNALSAQMCDDITSALNNADEQARDTAAIRAVLIRSVG
TTFCAGADLGSTTQSDDAAEVTQSDFHDSLTRMLESVVSCGVPVIADIQGPAVGAGMQLA
LSCDLRLVHHAAWFKVPAASLGFALDGWTINRAQCLLGGGWARSIFLGGATLSAPQAVAT
GFALEIADSDSAIAYAHRIAGMAPLALRQLKSALNSADFEYALVGESRDLFAQCWASTDA
REGQLARKQKRDPVFTGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaggtagaggtgcgtatcgacggccacctgatgtgtgtcaccttaaatagacac
gaggctcgcaacgcactttctgcacagatgtgcgatgatattacatctgctcttaataat
gcagatgagcaggcgcgtgacactgcagctattcgcgccgtgctcatccgctctgttggt
acgaccttttgtgccggagcagatttgggcagtaccacccaaagtgatgatgcggctgag
gtgacgcagtcggatttccatgactctcttacgcgcatgttggaatcggttgtttcctgt
ggagtcccagttattgctgatattcaaggaccagctgtcggcgctggcatgcagctggca
ttgagctgcgacctgcgtttggttcatcatgctgcatggtttaaggtcccggcggcgtct
cttgggttcgcgctggacggatggactattaatagggctcagtgtttgctgggcggtggt
tgggcgcgatcaattttcctgggcggcgcaacgctatcggcaccgcaggcggtggcaact
ggttttgcgctggagatcgctgattccgattctgcgattgcctatgctcatcgtattgct
ggaatggcacccttggcgctgcgacaacttaaatccgcgctcaacagtgctgattttgaa
tatgcgcttgttggggaatctcgtgatctttttgcccaatgttgggctagtacggatgct
cgcgaagggcagctggctcgaaaacaaaagcgagatccggtatttactggtcgctga

DBGET integrated database retrieval system