KEGG   Coxiella endosymbiont of Amblyomma americanum: Z664_02140Help
Entry
Z664_02140        CDS       T03533                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cea  Coxiella endosymbiont of Amblyomma americanum
Pathway
cea00550  Peptidoglycan biosynthesis
cea01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cea00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Z664_02140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cea01002]
    Z664_02140
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cea01011]
    Z664_02140
Enzymes [BR:cea01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Z664_02140
Peptidases [BR:cea01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Z664_02140
Peptidoglycan biosynthesis and degradation proteins [BR:cea01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Z664_02140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AJC50518
UniProt: A0A0A8E930
LinkDB All DBs
Position
complement(446043..447305)
Genome map
AA seq 420 aa AA seqDB search
MRSSYPYVKFITLCTISLLLSSFIIPNLMANADNIIRRDIDEGISTAAQIFKIQSSLIPP
PDNLNVRSYVLMDAKSGIIIAEKNMNLRLQPASLTKLMTLYITFQTLKTGKIRLLDDKAT
VSTNAWRTSGSRMFLKEGSHVPINSLIQGIVVASGNDACVTMAQYIAGSEETFAQMMNQV
AQHLGMKNSHYVNSTGLPYPNHYSTAYDMALLTRALIKNFPEYYYFFSKKWLTYNNIRQP
NHNRLLWRDISVDGLKTGYTKKAGYCLVASAQRKGMRLITVVFGAPTDNDRALASEILLN
YGFHFYKTQRLFNAHTPIIRKRIWLGKCKYINFGTVDSLYITLPIENNKNLKATIQFLDP
YLHAPIKKGQSYGIMSVTVSGNLVIKAPLMALQEDPISGLLSRVLDHIVLFLKKCLVKLL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcttcgtatccatatgtaaagtttattactctgtgtacaattagcttacttctc
tcttcttttatcattcctaatttaatggctaacgcagataatatcatccgacgagatata
gatgaaggaatttctactgcagctcagatatttaaaatacaatcatctttgataccacct
cctgataatttaaatgtaagaagttatgtactgatggatgctaaatcaggaattattatc
gctgaaaaaaatatgaatcttcgtttacaacccgctagtttaactaaattaatgacgctt
tatataacttttcaaacattaaaaacagggaaaattcgtttattggatgataaagcaaca
gttagtacaaatgcatggcgtacaagcggatctaggatgttcttaaaagaaggttcacat
gtgccaattaatagtcttattcaaggtattgttgttgcttctggaaacgatgcttgtgta
acgatggctcaatatatagctggatcagaagaaacatttgcccaaatgatgaatcaggta
gcacaacatcttggaatgaaaaactcgcattacgtaaattctacaggattaccttacccg
aatcattattctactgcttacgatatggctcttttaactcgtgctcttattaaaaacttt
cctgaatactactattttttttctaaaaagtggttaacttacaataacattagacaacct
aatcacaatcgtttgctatggcgtgatatttcagtagacggcttaaaaactgggtatact
aaaaaagcaggttattgtttagtcgcatccgcacaacgtaaaggtatgcgattaattact
gtagtatttggggcacctactgataacgatcgcgcgcttgcttctgaaattctattaaac
tatggatttcatttttataaaactcaacgactgtttaacgctcatacacctattattcga
aaacgtatttggttaggtaaatgtaaatatataaattttggtacagtagattctttgtac
atcactcttcctatagaaaataataaaaatctaaaagctactattcaatttttagatccg
tatttacacgcgccaataaaaaaaggtcaatcctatggaataatgagtgttacagttagt
ggaaatctagttatcaaagcaccgttaatggcattacaagaagatccgatatcaggtcta
ttatcccgagttctagatcatattgtactttttttaaaaaaatgtttagtaaaactttta
taa

DBGET integrated database retrieval system