KEGG   Cellvibrio sp. PSBB023: B0D95_05370Help
Entry
B0D95_05370       CDS       T04725                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
ceb  Cellvibrio sp. PSBB023
Pathway
ceb00020  Citrate cycle (TCA cycle)
ceb00270  Cysteine and methionine metabolism
ceb00620  Pyruvate metabolism
ceb00630  Glyoxylate and dicarboxylate metabolism
ceb00680  Methane metabolism
ceb01100  Metabolic pathways
ceb01110  Biosynthesis of secondary metabolites
ceb01120  Microbial metabolism in diverse environments
ceb01130  Biosynthesis of antibiotics
ceb01200  Carbon metabolism
Module
ceb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ceb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ceb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ceb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B0D95_05370
   00620 Pyruvate metabolism
    B0D95_05370
   00630 Glyoxylate and dicarboxylate metabolism
    B0D95_05370
  09102 Energy metabolism
   00680 Methane metabolism
    B0D95_05370
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    B0D95_05370
Enzymes [BR:ceb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     B0D95_05370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AQT59582
UniProt: A0A1U9N7F5
LinkDB All DBs
Position
complement(1200933..1201916)
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVTVTGAAGQISYSLLFRIAAGDMLGKDQPVILQLLEITPALKALQGVAMELDDC
AFPLLAGIVTTDDPSVAFKDTDYALLVGARPRGPGMERKDLLAANAAIFSVQGKAINDHA
SRNIKVLVVGNPANTNALIAQRNAPDINPRQFTAMTRLDHNRALSQLATKTGTSINNITK
ALIWGNHSSTQYPDLHNTLVDGKPALSLVDQAWYEADYIPTVQQRGAAIIAARGASSAAS
AANAAINHIRDWALGTPANDWTSMGVYSDGSYGIEKGLIYSFPVVCKNGDWEIVQGLDIN
EFSRARMTATEKELQEERDAVKELLPA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacctgtaagagttaccgtcactggcgccgcaggccaaatcagctactcattg
ttgttccgcatcgctgctggcgacatgttaggtaaagatcaacccgttatcctgcaattg
ctggaaatcaccccggctctgaaagcactgcaaggtgtagcgatggaattggacgattgt
gcattcccattgttggctggcattgtgactactgatgacccatcggttgccttcaaagat
accgattacgcactgttggtaggcgcacgtccacgcggcccaggtatggagcgtaaagat
ctgctggctgctaacgccgcgatcttctctgtacaaggcaaggcaatcaacgatcacgcc
tcacgcaacatcaaagtattggtagttggtaaccctgccaacaccaacgcattgatcgca
cagcgcaatgcacctgacatcaacccacgtcaattcactgccatgacccgtttggatcac
aaccgtgcactgtcccagttggcgaccaaaaccggcaccagcatcaataacatcaccaaa
gcactgatctggggtaaccactcatctacccaatacccagacctgcacaacaccttggtt
gatggcaagccagcgttgagcctggttgatcaagcatggtacgaagcagattacatccca
actgtacaacaacgtggtgctgccattattgctgcacgcggcgcttcttctgctgcgtct
gcagcaaacgcggcaatcaatcatatccgcgattgggcactgggcactccagcaaatgat
tggaccagcatgggcgtatacagcgatggctcttacggcattgaaaaaggcctgatctac
tcattccctgttgtgtgtaaaaacggtgattgggaaatcgtacaaggtttggatatcaac
gaattctcacgcgctcgtatgactgcaaccgaaaaagaattacaagaagagcgtgatgca
gtgaaagagttgctgcctgcgtaa

DBGET integrated database retrieval system