KEGG   Cellvibrio sp. PSBB023: B0D95_10580Help
Entry
B0D95_10580       CDS       T04725                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ceb  Cellvibrio sp. PSBB023
Pathway
ceb00473  D-Alanine metabolism
ceb00550  Peptidoglycan biosynthesis
ceb01100  Metabolic pathways
ceb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ceb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B0D95_10580
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B0D95_10580
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    B0D95_10580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ceb01011]
    B0D95_10580
Enzymes [BR:ceb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B0D95_10580
Peptidoglycan biosynthesis and degradation proteins [BR:ceb01011]
 Precursor biosynthesis
  Amino acid ligase
   B0D95_10580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATP-grasp RimK ATPgrasp_ST TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AQT60488
UniProt: A0A1U9NAL5
LinkDB All DBs
Position
complement(2418838..2419809)
Genome map
AA seq 323 aa AA seqDB search
MQAVKLPVDEALKKQIGRVGVLFGGLSAEREISLQSGAAVIAALVEAGIEHVTIDVGHNI
IADIQAAKIDRAFLILHGPGGEDGRIQALLEFLNIPYTGSDVQSSALAMDKLRTKQLWRG
VDINGKQGLPTPEFAVLNGNSNFAQVLAHLGGDVMVKPANEGSSIGMSRVNTAADLEAAF
NKAAQYQGSVLVERLIVGSEYTVAILDGEALPPIKLETDHSFYDFNAKYIAEDTRYLCPC
GLSAEKEQELKNLALNAFRTVGCRGWGRVDVMADQQQNFYLLEVNTAPGMTSHSLVPMAA
KAIGLSFTELVLTILRASVKDKA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagtcaagttgcctgtcgatgaggcgctaaaaaaacaaattggtcgcgtaggc
gtgttatttggtggcctttccgctgagcgtgaaatttcattgcaaagtggtgccgccgtg
attgctgctttggttgaggcgggcattgagcatgtgacaatcgatgtgggtcacaatatt
attgccgacattcaagccgcaaaaatcgatcgcgcatttttaatactgcatggcccaggt
ggggaagatggtcgcattcaagccttgctggaatttttaaatattccctataccggtagt
gatgtgcagtcatcagccttggcaatggataagttgcgcaccaaacaattgtggcgtggt
gttgatataaacggcaaacaaggtttaccaacaccggaatttgcagtgctgaacggcaat
tcaaactttgcgcaggtacttgcccatttgggtggcgatgtgatggtgaaaccggcaaat
gaaggttccagcattggtatgtcgcgtgtgaatactgctgccgatttggaagccgctttc
aataaagcggcgcaatatcagggcagtgtgttggtggagcgtttgattgtgggcagtgag
tacaccgtagcgattcttgatggtgaagccttgcctcccatcaaattagaaacagaccat
agtttctacgacttcaatgccaagtacatcgccgaagacactcgctatctttgcccttgt
ggtttgtcagcagaaaaagaacaggaattaaaaaacctggcattgaatgcgttcagaacc
gtagggtgtcgtgggtggggacgagtggatgtaatggccgatcaacaacaaaacttttac
ttgttggaagtgaacacggcgcccggcatgaccagtcatagcctggttcccatggctgct
aaggcgattggtttgtcgtttactgaattggtactgacaattttgcgcgcaagcgtgaaa
gacaaagcataa

DBGET integrated database retrieval system