KEGG   Cellvibrio sp. PSBB023: B0D95_12170Help
Entry
B0D95_12170       CDS       T04725                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ceb  Cellvibrio sp. PSBB023
Brite
KEGG Orthology (KO) [BR:ceb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B0D95_12170
Enzymes [BR:ceb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     B0D95_12170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_3 FAD_binding_2 FAD_oxidored AlaDh_PNT_C Glutaredoxin NAD_binding_8 DAO Thi4 Thioredoxin_9 NAD_binding_7 Thioredoxin_4 K_oxygenase FMO-like Chalcone_N
Motif
Other DBs
NCBI-ProteinID: AQT60748
UniProt: A0A1U9NBC1
LinkDB All DBs
Position
complement(2791283..2792848)
Genome map
AA seq 521 aa AA seqDB search
MLDAAIKGQLTAYLEKLQAPIELIASLDSSAKSTEMLSLLEEITTLSNKVSLRQNGSATL
TPSFHIGAVGSSARIQFAGIPMGHEFTSLVLALLHSGGHPPKVDAKTIEQIKAIDTPLHF
EVFVSLSCHNCPDVVQAVNLMAALNPNISATMIDGALFQQEVDARKIMAVPTVFVNGEHF
GQGRMTLEEIIAKVDTGAAERDAKALSERAPYDVLVIGGGPAGAAAAIYSARKGIRTGVV
AERFGGQVLDTVSIENFISVKETEGPKLAMALEQHVKEYDVDVMNLQKAAQVIPGANQGD
LIEVKLASGASLKSKSIILATGARWREMNVSGEQEYRGKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSKLRADAVLQRKLFSLPNVTVITEAMTTEVIGNG
EKVTGLKYKSRNTDEIATVELEGIFVQIGLLPNTDFLKGTVQLTNRGEIEINSRGETSVP
GVFAAGDCTNVPYKQIIIAMGAGATASLGAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgccgcgatcaaaggccaactcactgcctaccttgaaaaactgcaagcgcct
atcgaactgatagcgagcttggactccagtgccaaaagcaccgaaatgttaagcctgttg
gaagagattactacgctctccaataaagtcagcctgcgtcaaaatggcagcgcaacatta
acgccgtcgtttcatattggcgctgtgggttccagtgcgcgcattcaatttgcgggcatt
ccgatgggccacgaatttacgtcgttagtgttggcattgctgcacagcggcggccatcct
cctaaagtggatgcaaaaaccatcgagcaaattaaggcgattgatactccattgcatttt
gaagtatttgtatcgctctcttgtcacaactgtccggatgtagtgcaggccgtgaattta
atggccgcgttaaatcccaacatttctgccaccatgatcgacggtgcattgtttcaacaa
gaagttgatgcacgcaaaatcatggcggtgcccacggtatttgttaacggcgaacatttc
ggccaaggccgtatgacgctggaagaaattatcgccaaagtcgatacaggtgcggctgag
cgcgatgcaaaagcgctgagcgaacgcgcaccttatgatgtattggtcatcggcggcggc
ccagccggtgcagcggcagcaatttattccgcgcgcaaaggtattcgcactggtgtagtc
gccgagcgttttggtggtcaggtgttggatacggtatccatagaaaattttatttcggtc
aaagaaaccgaaggaccgaaattggcgatggccttggaacaacacgttaaagaatacgac
gtggatgtaatgaatctgcaaaaagccgcgcaggtgattcctggcgctaatcagggtgat
ttgattgaagtaaagctcgccagcggtgcgagtttaaaaagcaaaagtattattctcgcc
accggcgcacgctggcgtgaaatgaatgtatcgggcgagcaggaatatcgcggtaaaggt
gtcgcctactgtccacattgcgatggccccttatttaaaggtaaacgcgtcgcggtaatc
ggtggcggcaactccggtgtggaagcggcaattgatctggccggtatagttgctcatgtc
accctgattgagttcgattcaaaattgcgcgccgacgcggtattgcaacgtaaattattc
agcttgcccaacgtcaccgtcattaccgaagccatgactaccgaagtgatcggcaacggc
gaaaaagtgaccgggcttaaatataaaagccgcaataccgatgaaatcgcgacagtggag
ttggagggtatttttgtgcaaatcggtttgttacctaataccgatttcttaaaaggtacg
gtgcagctgactaatcgcggtgaaattgaaatcaattcgcgcggtgaaacgtctgtgccc
ggtgtattcgcggcgggcgattgcaccaacgtaccctacaagcagattattattgcgatg
ggtgcaggtgcaactgcatcgctcggcgcgtttgatcacttgattcgcaccagtgctccg
gcgtga

DBGET integrated database retrieval system