KEGG   Cellvibrio sp. PSBB023: B0D95_14185Help
Entry
B0D95_14185       CDS       T04725                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ceb  Cellvibrio sp. PSBB023
Pathway
ceb00500  Starch and sucrose metabolism
ceb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B0D95_14185
Enzymes [BR:ceb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B0D95_14185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AQT62459
UniProt: A0A1U9NFP9
LinkDB All DBs
Position
3260873..3262264
Genome map
AA seq 463 aa AA seqDB search
MGKASLTFTLALASIASVQHASADAILHAFDWNYSDVSAKATEIKNLGYKAVLVAPPLKS
NSANSAWWQRYQPQDIRVIDHARGNKQSFQTMVNALNAQGVAVYADIVLNHMANERNGAT
DFPGSAAISTYNSNTTYWNNQKLFGDLTQGLFGGYDFNPANCISDYNDVWQVQNWRLCGG
SGDTGLPDMNPNSWVVTQQRNYLTALKNMGVKGFRVDAAKHMTAYHLNQIFTSTIKTNMY
VFGEIITGGGAGNLDNDRFLSPYLRDTDHKAYDFPLFHSIRNAFGFGGSMSSLVNPQAVG
QAIDSFRAVTFTINHDIPLNSGFRSWIMDATDEKLAYAYIMGRDGGKPLIFSDSTGTDTN
RWVNAYKAPHIAAMIRFHNTVQGQGMEVLAHNSCAILFRRGEEGVVGINKCTSQQNFSVN
TNNRFKWYRNYRDVLTNNALVYINSSSYTFALPARTARMWLPE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atcggcaaagcgtcattaacctttactctcgcgctggccagtattgccagtgtacagcac
gctagtgcggacgccattttacatgcgtttgactggaactatagcgatgtttctgccaag
gccaccgaaattaaaaaccttggctacaaagcggtattggtcgcgccaccgttaaaatcc
aattcggctaattcagcctggtggcaacgttaccagcctcaggatattcgtgtgattgac
catgcacgcggcaacaagcagagcttccaaaccatggtgaacgcgctgaatgcacagggc
gtggcagtgtatgccgatatcgtattgaaccacatggcaaatgagcgcaatggcgctacg
gatttccccggctctgccgcgattagtacctataactccaacactacttactggaacaat
caaaaattatttggcgatttaacccagggtttatttggcggttacgattttaatcccgca
aattgtattagcgattataacgatgtatggcaagtacaaaactggcgcctgtgcggtggc
agtggcgatacaggcttgccagacatgaaccccaacagttgggtggtaacgcaacagcgc
aattatttaaccgcgctgaaaaatatgggcgtaaaaggcttccgcgtagatgccgccaaa
cacatgacggcctatcacctgaatcaaatttttacgtcgaccattaaaaccaatatgtat
gtatttggtgaaattatcaccggcggtggtgcgggcaatttggataacgatcgcttcctc
agcccttacttgcgcgataccgatcacaaagcttacgatttcccactcttccatagcatt
cgcaatgcctttggttttggcggcagcatgagttcgctggtaaacccgcaagcggtaggc
caggcgattgattctttccgcgcggtgacctttaccatcaaccacgatattcccttgaac
agcggtttccgcagctggattatggatgcaaccgatgagaaattagcctatgcctacatt
atgggacgcgatggcggcaagccattaattttcagtgatagtactggcactgatacaaat
cgctgggtgaatgcttacaaagcgccccatattgcagccatgattcgcttccataacact
gtgcaaggccaaggtatggaagtgctggcacacaatagttgcgcgattttattccgccgt
ggtgaagagggtgtggtgggtattaataaatgcaccagtcaacaaaacttcagtgtgaat
accaacaatcgctttaagtggtatcgcaattaccgcgatgtgctgaccaacaacgctttg
gtttatatcaatagcagtagctatacctttgccttacctgcacgcacagcgcgtatgtgg
ttgccggaataa

DBGET integrated database retrieval system