KEGG   Cellvibrio sp. PSBB023: B0D95_18155Help
Entry
B0D95_18155       CDS       T04725                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ceb  Cellvibrio sp. PSBB023
Pathway
ceb00500  Starch and sucrose metabolism
ceb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B0D95_18155
Enzymes [BR:ceb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     B0D95_18155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AQT61805
UniProt: A0A1U9NE62
LinkDB All DBs
Position
complement(4196616..4199021)
Genome map
AA seq 801 aa AA seqDB search
MKKKLLAILVSSSLLLGACSDNSSTTSTSTAPSAVAPGAPGNAAVWSYAGKTGIGTSYEQ
YTDGAYKDTGATGTISKVWFSIAQGVLTETMYGLIHEAQLQELQFFVKGDGFLDEEKKDT
ISTVEYLITDDQGRPQSLAYKIVNRDKEGKYEIEKHIFTDPDSQTLMMRVQFRALTADVT
PYVYVNPSIANTGSNDSARSVDGVWIATDGDTSMTVKTTAQVTQSTVGFEGVSDGIADLK
QHGALTQAYNTTGDSKGNVAMTLQLAEVKSGASTQWDLVLGFGKTPTDSTAAAEQTLAKG
YDKVLAHYNGDGDAIGWRDFLQTLPALEKLSATATDGGKLAYTSAMVLKAQEDKTHAGAF
IASLSNPWGDTKSAEKSATGYKAVWPRDFYQVAMAMLALGDRESPRIAFEYLEKIQASDK
IAGYSGTPGWFLQKTHVDGEVEWVGVQLDQTGMPLMLGWRLWKEGIFSDAEITQWYNTML
KPAADFLVNGGQVKILWNDTTIKPPYTQQERWEEQQGYSPSTTAAIIAGLVSAADIATQA
GDTEGAAKYLAAADKYSSELEAKTFTTNGSLTGDLGNGQYYLRINANEDPNDRSALGTSN
AQVINDESQVIDGGFLELVRYGVRAATDKHVLETIPEYDNLKLPDLLRTKYEFTFPGVEG
TFPGWRRYGIDGYGEEITAGKGYVEANNSTDGRGRVWPFFTGERGHYELELAKANASVDI
NALRNTYVKAMELFANEGMMLPEQVWDGVGNNDTYNYRLGQGTNGATPLAWTHAEYIKLL
RSYSDGKVWDRNDSTEARYVK
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaaactactcgccattttggtgagcagcagccttttgctcggcgcctgctcc
gataactcatccacaacatcaacctccactgcaccttctgctgtagcacctggcgcgccc
ggcaatgccgctgtttggtcttacgcgggcaaaaccggtataggtacgtcttacgagcaa
tacaccgatggcgcttacaaagatactggcgcaaccggcaccatctccaaagtgtggttt
tccatcgcgcagggcgtgttaacagaaaccatgtatggcctgatccacgaagcccaattg
caagaattgcagttttttgtgaaaggtgatggtttcctcgacgaagaaaagaaagacacg
atttccactgtcgaatacttaattactgacgatcaaggtcgcccacaatccctcgcgtac
aaaattgtgaatcgcgataaagagggaaaatacgaaattgaaaaacacatttttaccgat
ccggattcacaaaccttgatgatgcgcgtgcaattccgtgcactgaccgccgatgtaaca
ccttacgtttatgttaatccgtctattgccaacaccggcagtaatgacagcgcccgctct
gtggatggcgtgtggatcgcgaccgatggcgacaccagtatgaccgtcaaaaccaccgct
caggtaacgcaaagtacagtaggatttgaaggcgtatccgacggtatcgccgaccttaaa
cagcatggcgcactcacacaagcctacaacactaccggcgacagcaagggcaacgtcgcc
atgaccttgcagcttgctgaggtgaaatccggtgcgagtacgcaatgggatctggtgtta
ggttttgggaaaacaccaaccgacagtaccgctgctgccgagcaaaccctggcgaagggc
tatgacaaggtactggcgcattacaacggtgacggcgatgccatcggctggcgtgacttt
ttacaaaccctgcccgcactggaaaaactctctgccacggcgactgacggcggcaagctg
gcctacaccagcgccatggtgttaaaagcgcaagaagacaaaacccacgccggcgccttt
atcgcctccctatccaacccttggggcgataccaaatctgccgagaaatccgctaccggc
tataaagcggtttggccgcgcgatttctatcaagtcgccatggcgatgctcgcgttgggt
gatcgtgagtcaccgcgtatcgcctttgaatatctggaaaaaattcaggcgagtgacaaa
atcgcaggctacagcggcacacccggctggttcttgcaaaaaacccatgtggatggcgaa
gtggaatgggtaggcgtacaactggatcaaaccggtatgccactcatgctcggctggcgc
ctgtggaaggaaggcattttcagcgatgccgaaatcacccagtggtacaacacaatgctc
aagcctgcagccgacttcctcgtgaacggcggtcaggtgaaaatcctctggaacgacacc
accatcaaaccgccctatacccagcaagagcgttgggaagagcagcaaggctattcgccc
tcaactactgcggcgattatcgccgggctggtatcggcggcggatatcgccacccaagcg
ggcgacactgaaggcgcagccaaataccttgcagccgccgataaatattccagcgagctg
gaagccaaaacatttaccaccaatggctcactcactggcgatttgggtaacggccagtac
tatttgcgcatcaacgccaacgaagaccccaatgatcgctcggcactgggcaccagcaac
gcgcaggtgatcaacgatgaatcccaggttattgatggcggctttctggaactggtgcgc
tacggtgtacgcgcggcaaccgacaagcatgtactggaaaccatccccgagtacgacaac
ctcaaactgcccgacttgctgcgcaccaaatatgaattcaccttccccggtgtagagggc
acattccccggctggcgccgttacggtatagacggttacggtgaagaaatcaccgctggc
aaaggctatgtggaagccaacaactctaccgatggccgcggccgcgtctggcccttcttt
accggcgagcgcgggcactatgaactcgaactggcaaaagccaatgccagtgtcgatatc
aacgccctgcgcaatacctatgtcaaagccatggagctgtttgccaacgagggcatgatg
ctgccagagcaagtatgggatggtgtaggcaacaacgacacttacaactatcgcctgggc
caaggcaccaacggcgccacccccttagcctggacccacgcggaatacattaaactgctg
cgcagctatagcgacggcaaggtgtgggacagaaacgacagcactgaagcgcgctatgtg
aagtaa

DBGET integrated database retrieval system