KEGG   Dickeya fangzhongdai ND14b: LH89_06900Help
Entry
LH89_06900        CDS       T03347                                 

Definition
(GenBank) exonuclease
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
ced  Dickeya fangzhongdai ND14b
Brite
KEGG Orthology (KO) [BR:ced00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ced03400]
    LH89_06900
DNA repair and recombination proteins [BR:ced03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     LH89_06900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SbcCD_C SMC_N AAA_29 ABC_tran cobW AAA_21 NTPase_1 AAA_22 AAA_25 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AIR68955
LinkDB All DBs
Position
1588279..1591962
Genome map
AA seq 1227 aa AA seqDB search
MKILSLRLKNLNSLQGEWKIDFTREPFASNSLFAITGPTGAGKTTLLDAICLALYHQTPR
LKVGPSQNELMTRHTAECLAEVEFEVKNVAYRAFWSQRRAHNSPEGNLQPPKVELALCAD
GKILTDKVNDKLTMIADITGLDFDRFTKSMMLSQGQFAAFLNADANQRAELLEELTGTDI
YGQISERVFEKHKDAQSKLETLRAQVATLELLSDEQRQALEQQLEAIRQQEQSLSLHREE
VLGHQRWYDTLLQLQQAQQQAQQQRAAQEQLQQQSQSQLDKLQRSEPAEKLRPRFDERER
ALREKQRLTQQLNSVRQQISRQQDALNLLKIQLEKAQATRQQHAEHRQQQETLINERILP
LDHHIATQQAQRAQQQQALDNLLEQQKTLIASLTRLQRQQEQTRQRLEDIENYRQQHSRH
QHLGSHIPLWQAQFPQQQKWQQDLQVLQEKAAQQQIQAEYLDQQRASLAEKHQAQQSACE
RASQLLTEHLQQDEQLEAEQPLADLRQQLARLMAERPDRQQLATSAAVLQQLISQRTLLE
AQQLDTQRRIQALEDQQTHQRQDYQRQADHLADLDKRHELELRIVSLERERQQLQPGKEC
PLCGSPHHPAVERYQALRPSETQLRLHALRQEVEALKASVVQTETQLQLQKQHRLQQQNA
LDGVRRDYESLQLQCKSVSERLLVDFDPLQLPALHQWIEESNVQEQSLQAQIASRERNQR
HIQESKDLLTSAQQLLAQTVQQLELNTQQQSSLHASREELRLLLEKTERELQRLHDSLSQ
TLETFELTAPTLAQQEDWLRQRQTEWLRWQENEHEQHQCQPQLAALEAEIIASQQRQEET
DAAIKTYQQQLADTQRSLEQAQQQRWQLMGNQAVNEVLKQLRQVSQTLELESQQAQQQWQ
QGQSLHSRLNGEIGSLEQQNQHAETALQQLQTGFAEELAAAGFADEAAFRHALLAEAERH
HLLTLKERLSQRQQQVDALQQQADSALEQHMTTRPESMPEGISDHDIRQLLSGLGDMVKA
EAAHQGELRQQLASDQQRRDKQRLLLEAIARGQQQCDDWGYLNQLIGSQKGDKFRRFAQG
LTLDHLVFLANRQLSRLHGRYLLQRKASDTLELQVADTWQADAVRDTRTLSGGESFLVSL
ALALALSDLVSTKTRIDSLFLDEGFGTLDGETLDTALDVLDNLNASGKSIGVISHVEAMK
DRIQVQIRVRKRNGLGVSQLDSAYAVK
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcttagcctgcgcctgaaaaacctcaactcgctgcagggcgagtggaaaatc
gatttcacccgcgagccgttcgccagcaacagcctgttcgccatcaccggccctaccggc
gcaggtaaaaccacgttgctggacgccatctgcctcgcgctgtaccaccagacgccgcgc
ctgaaggtcggccccagccagaacgagctgatgacgcgccacaccgccgaatgtctggcg
gaagtggaattcgaggtgaagaacgtcgcctaccgcgccttctggagccagcgccgcgcc
cataacagcccggaaggcaatctgcagccgcccaaggtggagctggcgttatgcgccgac
ggcaaaatcctcaccgataaggtgaacgataagctgacgatgattgccgatatcaccgga
ctggatttcgatcgtttcaccaaatcgatgatgctgtcccaggggcagttcgccgctttc
ctaaacgccgatgccaatcagcgggccgaactgctcgaagagctgaccggcaccgacatt
tacggccagatttcggagcgggtattcgagaaacacaaagacgcccagagcaagctggaa
accctgcgggcgcaggtcgctacgctggaattgctgagcgacgaacagcgccaggcgctg
gagcagcagttggaagccatccgccagcaggaacaatcgctgtcattgcaccgggaagag
gtgttggggcatcagcgctggtacgatacgctgctgcagctccagcaagcgcaacagcag
gcccagcagcagcgcgccgcgcaggaacaattgcagcaacaatcgcaatcgcagttggat
aaactacagcgcagcgaaccggcggaaaaactgcgtccgcgctttgatgaacgcgagcgc
gcgctacgggaaaaacagcgcctgacccagcagttaaatagcgtccgccaacagatcagc
cgccagcaggatgcgctcaatctgttgaaaatccagctggaaaaagcgcaggccacccga
cagcagcacgccgagcatcgccagcaacaggaaaccttgatcaatgaacgtatcctgccg
ctcgaccatcacatcgccacccagcaggcccagcgcgcccagcaacagcaagcgctggat
aacctgctggagcagcagaaaacgctgatcgccagcctgaccagactacagcgccagcag
gaacagacacggcaacggctggaagacatcgaaaactatcgccagcagcatagccgccac
cagcatttgggcagccatattccgctgtggcaggcgcaatttccccagcagcagaaatgg
cagcaggacttgcaggtgctgcaggaaaaagcggcgcagcagcagattcaggcggaatac
cttgaccagcagcgcgcctcgctcgccgaaaaacatcaggcgcagcaaagcgcctgcgag
cgagcgagccaactgctgaccgagcacttgcagcaggatgaacagctggaagcggagcaa
ccgctggcggacctacgccagcaactggcccggctcatggccgaacggccggatcgccaa
caactggccaccagcgccgccgtgctacagcagttgattagccagcgcaccctgctggaa
gcgcaacagctggacacccaacgccgcattcaggcgctggaagatcaacagacccatcag
cgtcaggactatcagcgtcaggccgaccatctggccgacctcgacaaacgccacgaactg
gagctgcgcatcgtcagtctggaacgcgagcgccagcaactgcaaccgggcaaagagtgc
ccgctgtgcggctccccgcatcatccggcggtggaacgctatcaggcactgcgtccttcg
gaaacccagctccggctgcatgcgctgcgtcaggaggtggaggcgctgaaagccagtgtg
gtgcagaccgaaacccagcttcagttacaaaaacagcaccgcctgcagcagcaaaacgcg
ctcgacggcgtccgacgcgattacgagtcgctgcagttgcagtgcaaatcagtcagtgaa
cgcttactcgttgatttcgatccgctgcaactgccggccctgcatcagtggattgaagaa
tccaacgtgcaggagcagtcgctgcaagcgcagatcgccagtcgtgagcgtaatcagcgc
catattcaggaaagtaaggatttactcacctcggcgcagcaactgctggcgcaaaccgta
cagcagctggagctgaacacccagcaacagtcgtcgctgcacgcctcgcgggaagaactg
cggctgttgctggaaaaaaccgaacgcgagttgcaacgcctgcacgacagcctcagccag
acgctggaaacgttcgaactgacggcgcctacgctggcgcagcaggaagactggctgcgt
cagcgccagacggaatggctgcgctggcaggaaaacgaacacgaacagcatcagtgccag
ccgcaacttgccgcgctggaagcggaaatcatcgccagccagcagcggcaggaagaaacc
gacgccgccatcaaaacctatcagcagcaactggccgacacccaacgctccctggaacag
gcgcagcaacagcgctggcaattgatgggcaatcaggcggtgaatgaggtgctgaagcag
ttgcggcaggtcagccagacgctggagctggaaagccagcaggcgcagcagcagtggcaa
cagggccagtcgttgcacagccgcctgaacggggaaatcggcagtctggagcagcaaaac
cagcatgccgaaaccgcattgcagcagcttcagaccggatttgcggaagagctggccgcc
gccggattcgccgatgaagctgccttccgccatgccttgctggccgaggccgagcgccat
catctcctcacgctaaaagagcggctcagccagcgtcagcagcaggtggatgcgttgcag
cagcaggcggacagcgcgctggagcaacacatgaccacccggccggaatcgatgccggaa
ggcatcagcgaccatgacatccgtcagttgctttccggcctcggggacatggtaaaagcc
gaagccgcacatcagggcgaactgcgccagcagcttgccagcgatcagcaacgccgcgac
aaacagcgcctgttgctggaggccatcgcccgcggtcagcaacagtgcgacgactggggc
tacctcaatcagttgattggctcgcagaaaggcgacaaattccgccgcttcgcgcagggg
ctgacgctggatcatctggtgtttctggccaaccgccagctgtcgcgtctgcatgggcgc
tacctgctgcagcgcaaggcatccgacacgctggaattgcaggtggccgatacctggcag
gccgacgcggtacgcgatacccgcacgctgtccggcggcgaaagttttctggtcagcctg
gcgctggcgctggcgctatccgatctggtcagcaccaaaacccgcatcgactcgctgttc
ctcgacgaaggttttggcacgctggacggcgagacgctggataccgcgctggacgtactg
gataacctgaatgcttccggcaagagcatcggcgtcatcagtcacgtggaggcgatgaaa
gatcgtatccaggtgcaaatccgggtcagaaagcgcaacggtctgggcgtcagccagctc
gacagcgcgtatgcggtgaaataa

DBGET integrated database retrieval system