KEGG   Dickeya fangzhongdai ND14b: LH89_09720Help
Entry
LH89_09720        CDS       T03347                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ced  Dickeya fangzhongdai ND14b
Brite
KEGG Orthology (KO) [BR:ced00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LH89_09720
Enzymes [BR:ced01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LH89_09720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like NAD_binding_8 Thi4 FAD_binding_3 DAO AlaDh_PNT_C K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AIR69466
LinkDB All DBs
Position
complement(2229983..2231545)
Genome map
AA seq 520 aa AA seqDB search
MLDNNMQLQLKAYLEKLTKPVELVATLDDSAKSAEVRELLTEIAGLSDKVSFFENNDLPV
RKPSFLITNPGSANGPRFAGAPMGHEFTSLVLALLQTGGHPSKEAKELLDQIRDLDGKFH
FETYYSLTCHNCPDVVQALNLMSVLNPNVTHTAIDGGVFQDEIKDRNIMGVPTVFLNGEH
FSQGRMSLGEIVGKIDTGANARVVDKLNSRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
VGERFGGQILDTVDIENYISVPKTEGAKLATALKTHVDDYDVDVIDLQSAQKLIPASEPG
QPHQIETVSGAVLKSRSIIIATGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQDKLRSLPNVDVIVNAQTTEVLGD
GQKVTGLQYKDRVTDSVHKLALEGIFVQIGLLPNTGWLEGAVDRNRIGEIEIDARCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaataatatgcagctccagttgaaagcctatctggaaaaattaaccaaacct
gttgagttagtggcgacgctggacgactcagccaaatccgctgaagttcgggaactgctg
accgaaatcgccgggttgtccgataaagtcagtttctttgaaaataacgatctgccggtg
cgtaagccttcgttcctgataaccaatccgggatcggccaacgggccgcgttttgccggt
gcgccgatggggcatgaatttacttcgctggtgctggcgttattgcagaccggtggtcac
ccgtcgaaagaagcgaaagaattactcgatcaaattcgcgatctggacggcaaattccac
tttgaaacctattactcgctgacctgccacaactgtccggatgtggtgcaggcgctgaat
ttaatgtccgttctgaacccgaacgtcacccacaccgcgattgacggcggcgtgtttcag
gatgagatcaaagaccgcaatatcatgggcgtgcccacggtattcctgaacggcgaacac
ttcagccagggccgcatgagcctgggggaaatcgtcggcaagatcgacaccggcgccaac
gcccgcgtggtcgacaaactgaatagccgcccggtgtatgacgtgctgatcgtcggcagc
ggcccggcgggcgcggcggccgccgtgtacgcggcccgtaaggggatccgcaccggtctg
gtgggcgagcgtttcggcggccagattctggataccgttgatatcgaaaactacatttcg
gtgccgaagaccgaaggcgccaaactggcgaccgcgctgaaaacccacgtagacgactac
gatgtcgacgttatcgatctgcaaagcgcgcagaaactgattccggcttccgaaccgggt
caaccgcaccagattgaaaccgtctccggcgcggtgctgaaatcccgcagcatcatcatt
gccaccggcgcgcgctggcgcaacatgaacgtgccgggcgaagatcagtaccgcacccgc
ggcgtgacctactgcccgcactgcgacggcccgctgttcaaaggcaagcacgtggcggtg
atcggcggcggtaactccggcgtggaagcggccatcgacctggcgggcgtggtgaagcac
gttaccctgctggagttcgcgccggagctgaaagcggactcggtgttgcaggacaaactg
cgcagcctgccgaacgtggacgtgatcgtgaatgctcagaccaccgaagtgctgggcgac
ggtcagaaagtcaccggcctgcagtacaaagatcgcgttactgacagcgttcacaagctg
gcgctggaagggattttcgtgcagatcggcctgctgcccaacaccggctggctggaaggc
gcggttgaccgcaaccgtatcggtgaaatcgaaatcgatgcccgttgcgaaaccagcgtg
aaaggcgtgtttgcggcgggcgactgcaccaccgtgccttacaagcagatcattatcgct
accggcgaaggggccaaagcctccctgagcgcgtttgattatttgatcagaacccaggct
tga

DBGET integrated database retrieval system