KEGG   Dickeya solani ND14b: LH89_11310Help
Entry
LH89_11310        CDS       T03347                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ced  Dickeya solani ND14b
Pathway
ced00620  Pyruvate metabolism
ced00680  Methane metabolism
ced01100  Metabolic pathways
ced01120  Microbial metabolism in diverse environments
ced01200  Carbon metabolism
Module
ced_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ced00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH89_11310
  09102 Energy metabolism
   00680 Methane metabolism
    LH89_11310
Enzymes [BR:ced01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LH89_11310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIR69760
LinkDB All DBs
Position
2565424..2568063
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGANILERVETIRKLSKASRAGSETHRQELLTTL
QNLSNEELLPVARAFSQFLNLTNTAEQYHSISPHGEAASNPEALATVFRSLKSRDNLSDK
DIRDAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHDDLADYERHQIMRRLRQ
LIAQYWHTDEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLRELDEQMDKELGYRLPVDS
VPVRFTSWMGGDRDGNPNVTAEVTRRVLLLSRWKAADLFLRDVQVLVSELSMTTCTPELQ
QLAGGDEVQEPYRELMKTLRAQLTATLNYLDARLKGEQLVAPKDLLVTNEQLWDPLYACY
QSLHACGMGIIADGQLLDTLRRVRCFGVPLVRIDVRQESTRHTDALAEITRYLGLGDYES
WSESDKQAFLIRELNSKRPLLPRQWEPSADTQEVLETCRVIAETPRDSIAAYVISMARTP
SDVLAVHLLLKEAGCPYALPVAPLFETLDDLNNADSVMIQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYRAQDALIKTCEKYGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKFGLPEVTISSLSLYTSAILEANLLPPPEPKQEWHHIMNEL
SRISCDMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVIDDGHQNQLEDMCRDWPFFSTRIGMLEMVFAKADLWLAE
YYDQRLVEEKLWSLGKQLREQLEKDIKAVLTISNDDHLMADLPWIAESIALRNVYTDPLN
VLQAELLHRSRQQDTPDPQVEQALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaatattccgccatgcggagcaatgtcagcatgctgggtaaattgctcggc
gacaccattaaggatgcgctgggcgccaatatccttgagcgtgttgaaacaatccgcaag
ctgtccaaagcctcgcgagccggcagcgaaacacaccgtcaggaactgctgaccacactg
cagaacctgtccaacgaggagctgctgccggtcgcccgcgcgttcagccagttccttaac
ctgaccaacacggcggagcagtaccacagcatttctccgcacggtgaggcggccagtaac
ccggaagcgctggcgacggtgtttcgcagcctgaaaagccgtgacaatttgagcgacaag
gatatccgcgacgcggtggaatcgctctccatcgagctggtgctgaccgcgcacccgacc
gaaatcacccgccgcacgctgatccacaaactggttgaagtgaatacctgcctcaagcag
ctcgaccacgacgatttggccgactatgaacgccatcagatcatgcgccgtctgcgccag
ctgatcgcccagtactggcataccgatgaaatccgcaaaatccgcccgacgccggtggac
gaagccaagtggggcttcgcggtggtggaaaacagcctgtgggaaggggtgccggcgttc
ctgcgcgaactcgacgaacagatggataaagaactcggctatcgtctgccagtggattcg
gtaccggtacgcttcacctcctggatgggcggcgaccgcgacggcaacccgaacgtgacc
gctgaagtcacccgccgcgtactgctgttaagccgctggaaagctgccgatctgttcctg
cgcgatgtgcaggtactggtgtccgaactgtcgatgactacctgtaccccggagctgcaa
caactggcgggcggcgacgaggtgcaggaaccctaccgcgagctgatgaaaacgctgcgc
gcgcagttgaccgccaccctgaactatctggacgcgcgtctgaaaggcgagcaactggtc
gcgcccaaagatctgctggtcaccaacgagcagttgtgggatccgctgtatgcctgttac
cagtcgctgcatgcctgcggcatgggcatcatcgccgacggtcagttgctcgacaccctg
cgccgggtacgctgctttggcgtgccgctggtgcgtatcgacgtacggcaggagagcacc
cgtcacaccgacgcgctggcggaaatcacccgctatctggggctgggagactatgaaagc
tggtcggaatctgacaaacaggcgttcctgatccgcgagcttaactccaaacgcccgctg
ctgccgcgtcagtgggaacccagcgccgacacgcaggaagtactggaaacctgccgggtg
atcgccgaaaccccgcgcgattccatcgccgcctacgtgatctcgatggcacgcaccccg
tccgacgtgctggcggtgcatctgctgctgaaggaagccggctgcccgtacgcgctgccg
gtggcgccgctgttcgaaacgctggacgacctgaataacgccgacagcgtcatgatccag
ttgctcaacatcgactggtatcgcggcttcattcagggcaaacagatggtgatgatcggc
tattccgactccgccaaagacgccggggtgatggccgcctcctgggcccagtaccgcgcg
caggacgcgctgatcaagacctgcgagaaatacggcatcgcgctgacgctgttccacggt
cgcggcggctccatcggccgcggcggcgcgccggctcatgccgcgctgctctcccaaccg
ccgggcagcctgaaaggcggcctgcgcgtcaccgaacagggcgagatgatccgcttcaag
ttcggtctgccggaagtcaccatcagcagcctatcgctctacacctccgctattctggaa
gccaacctgctgccgccgccggaaccgaagcaggaatggcatcacatcatgaacgagctg
tcgcgcatttcctgcgacatgtaccgcggctacgtgcgggaaaacccggacttcgtgcct
tatttccgcgccgccacgccggaactggaactgggtaaactgccgctggggtcgcgcccg
gctaaacgccgaccgaacggcggcgtggaaagcctgcgcgccatcccgtggattttcgcc
tggacccagaaccgcctgatgctgcccgcctggctgggcgccggcgccgcgctgcaaaaa
gtgatcgacgacggtcaccagaaccagttggaagacatgtgccgcgactggccgttcttc
tccacccgcatcggtatgctggagatggtgttcgccaaggccgacctgtggctggcggaa
tactacgatcaacggctggtggaagagaaactgtggtcgctcggcaaacagctgcgcgag
cagttggaaaaagacatcaaggcggtactcactatctccaacgacgaccatctgatggct
gacctgccgtggatcgccgaatccatcgcgttgcgcaacgtctataccgacccgctcaac
gtgttgcaggcggaactgttgcaccgttcgcgtcagcaggacacgccggatccgcaggtg
gagcaggcgctgatggtcaccatcgccggcgtcgccgccgggatgcgcaataccggctaa

DBGET integrated database retrieval system