KEGG   Dickeya solani ND14b: LH89_13555Help
Entry
LH89_13555        CDS       T03347                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ced  Dickeya solani ND14b
Pathway
ced00730  Thiamine metabolism
ced00790  Folate biosynthesis
ced01100  Metabolic pathways
ced02020  Two-component system
Module
ced_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ced00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LH89_13555
   00790 Folate biosynthesis
    LH89_13555
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LH89_13555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ced04147]
    LH89_13555
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ced00537]
    LH89_13555
Enzymes [BR:ced01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LH89_13555
Exosome [BR:ced04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH89_13555
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ced00537]
 Enzymes
  LH89_13555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase NYN_YacP
Motif
Other DBs
NCBI-ProteinID: AIR70179
LinkDB All DBs
Position
complement(3068739..3070193)
Genome map
AA seq 484 aa AA seqDB search
MTMTRKALIRKTLISKTLISKTLLSSLMMTLIAGSALAASADYNRQAQGDITQPGGARRL
SADQTEMLKASLNAKTAKNVILLIGDGMGDSEITAARNYALGAGGFFKGIDALPLTGQYT
HYSLDKKTRKPDYVTDSAASATAWSSGVKTYNGALGVDVDSKDHKTLIEIAKAAGKATGN
VSTAELEDATPAAMVSHVTSRKCYGPEKTSQQCPTNALENGGRGSIAEQLLITRADVTLG
GGAATFKEIAKAGKYQGKSLTEQAEALGYHLVTDLDGMNAVTAASQSKPVLGLFADGNMP
VRWQGPKASYHGNLDKPVVTCEPNAQRGAGVPTLAQMTDKAIQLLSKNKNGFFLQVEGAS
IDKQDHAANPCGQFGETVDLDEAVQKALEFARRDGNTLVIVTADHAHSSQIVENGAKAPG
LTQALNTKDNAVMTISYGNSEEESQGHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKNA
MGLK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacccgtaaggctttgatccgcaaaaccttgatcagtaaaaccttgatcagc
aaaaccctgctctcttccctgatgatgacgcttatcgccggcagcgcactggccgccagc
gccgattacaaccgccaggctcagggcgatatcacccagcccggcggcgcgcgccgcctc
agcgccgatcagaccgagatgttgaaggcttcgctcaacgcgaaaaccgccaaaaacgtg
attctgctgattggtgacggcatgggcgactctgaaatcaccgcggcacgcaactacgcg
ctgggcgccggcggtttcttcaaaggcatcgacgcgctgccgctgaccggccaatacacc
cactactcgctggacaagaaaacccgcaaaccggattacgttaccgattccgctgcatcg
gccaccgcctggtccagcggcgtcaaaacctacaacggcgcgctgggcgtagatgtggac
agtaaagaccataagacgctgattgaaatcgccaaagcggcgggcaaagccaccggcaac
gtctccaccgccgaactggaagacgccacaccggccgcaatggtgtcgcacgtcacctcg
cgtaagtgctacggcccggaaaaaaccagccaacaatgcccgaccaacgcgctggaaaac
ggcggtcgcggctctatcgccgaacagctgctgattacccgcgctgacgtcacgctgggc
ggcggcgcagccaccttcaaagaaatcgccaaagcaggtaaatatcagggtaaaagcctg
acagaacaggcggaagcgctgggctaccacctcgtaaccgatctggacggcatgaatgcc
gttaccgccgccagtcagagcaaaccggtgctgggcctgttcgccgacggcaacatgccg
gtgcgctggcaggggccgaaagccagctaccacggcaacctcgataaaccggtagtgacc
tgtgaacccaacgcccagcgcggtgccggcgtaccgacactggcgcaaatgaccgataag
gccatccagctgttgagcaagaacaaaaacggtttcttcctgcaggtggaaggcgcctct
atcgacaaacaggaccacgccgccaacccgtgcggtcagttcggtgaaacggtggatctg
gacgaagcggtgcagaaagcgctggaattcgcccgtcgcgacggcaacacgctggtgatc
gtcaccgccgaccacgcccactccagccagatcgtcgaaaacggcgccaaagcgccgggc
ctgacgcaggcgctgaacaccaaagataacgcagtgatgaccatcagctacggtaactcg
gaagaggaatcgcagggacacaccggcacccagctgcgcatcgccgcctacggtccgcac
gccgccaacgtggtgggcctgaccgaccagaccgacctgttctacaccatgaaaaacgcg
atggggctgaaataa

DBGET integrated database retrieval system